(data stored in ACNUC7421 zone)

EMBL: CP002299.PE214

CP002299.PE214       Location/Qualifiers
FT   CDS_pept        complement(287442..287642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0214"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kra:Krad_2114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78302"
FT                   /db_xref="GOA:E3J611"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:E3J611"
FT                   /inference="similar to AA sequence:KEGG:Krad_2114"
FT                   /protein_id="ADP78302.1"
FT                   /translation="MPDDVFRRLRELAEAADRPLEEYLLAELARITATPTMDEVLDRIE
FT                   SRGSGRFGLQQAVDDLEAERR"
     gtgcccgacg atgtcttccg ccgtctgagg gagctggccg aggctgcgga tcggccgctg        60
     gaggagtacc tcctcgccga gctggcacgg atcaccgcga ccccgacgat ggacgaggtc       120
     ctcgacagga tcgagtcacg cggcagcggt cggttcggcc tccagcaggc cgtcgacgac       180
     cttgaagcag agcggcgctg a                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page