(data stored in ACNUC7421 zone)

EMBL: CP002299.PE215

CP002299.PE215       Location/Qualifiers
FT   CDS_pept        complement(287839..290109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0215"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: fal:FRAAL6636
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78303"
FT                   /db_xref="GOA:E3J612"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:E3J612"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ADP78303.1"
FT                   /translation="MALRIAIGGAITLIALAIAGRRFFWLFRLIQTGQPAEGRLDDIPT
FT                   RIWSEVSEVGGQRKLLKWSVPGLAHAFTFWGFTVLILTIIETFGGLFDEDFHIPWFGHW
FT                   AGIGFIEDFFAVAVLAGLATFAVIRVKRAPARLERKSRFYGSHLGPAWVILGMITAVIV
FT                   TLLITRGAQWNTGNLPQGKTKWAFASYAVSRVFSPLGHTANDAIETTFLLINLAIIMGF
FT                   LVLVAYSKHLHIFLAPINVVLKREPKALGALGTTPDIETLMEQDEPIIGAGKVEDFSWK
FT                   AMLDFSTCTECGRCQSQCPAWNTGKPLSPKLVIMDLRDHLFAKAPYLLGGTDTESRDAA
FT                   WDAAVAKAHEGHDHAPGEGHDHGDHDEHEVHGVPESGFARVAEPGKAQAERPLVGTAEE
FT                   GGVIDPDVLWSCTNCGACVEQCPVDIEHVDHIVDMRRYQVMIESAFPSEAGVMLRNLEN
FT                   NGNPWGVSPRSRTEWTDGLPFEVKVIGEGEQIPEDVEYLFWVGCAGAIEDRAKKVSRAF
FT                   AELLDMAGVKFAILGSQESCTGDPARRLGNEYLFQEMAKANIELLNETGVKKIVATCPH
FT                   CFNSLSKEYSGLGGNYEVVHHTQLLGKLVEEKKLVPITPIESSVTYHDPCFLGRHNKVY
FT                   TPPREILEAIPGLRGQEMHRCKDRGFCCGAGGARMWMEEKIGTRINANRVEEALGLDPD
FT                   VVSTACPFCIVMLSDAVTEQKLAGTAKESVEVLDVSQLLARSLAAPAAPTQDAPGAEPA
FT                   PMS"
     atggcgctga ggatcgcgat cggtggggcg atcaccttga tcgccctggc gatagccgga        60
     aggcgattct tctggctgtt cagactgatc cagactgggc agccggcgga agggcgtctg       120
     gacgacatcc cgacccggat ctggagcgag gtcagtgagg tcggcggcca gcgcaagctg       180
     ctgaagtggt cggtgcccgg cctcgcgcac gcgttcacct tctggggctt caccgtcctg       240
     atcctgacga tcatcgagac gttcggtggt ctgttcgacg aggacttcca catcccgtgg       300
     ttcggccact gggccggcat cgggttcatc gaggacttct tcgcggtcgc ggtgctcgcc       360
     ggtctcgcga cgttcgccgt catccgcgtc aagcgcgcgc ccgcccggct ggagcgcaag       420
     tcgcgcttct acggctcgca cctcggcccg gcctgggtca tcctcgggat gatcaccgcg       480
     gtcatcgtga cgctgctgat cacccgcggc gcccagtgga acaccggcaa cctgccgcag       540
     ggcaagacca agtgggcctt cgcgtcctac gccgtcagcc gggtcttctc gccgctcggg       600
     cacaccgcga acgacgccat cgagaccacg ttcctgctga tcaacctcgc gatcatcatg       660
     ggcttcctgg tgctcgtcgc gtactcgaag cacctgcaca tcttcctggc cccgatcaac       720
     gtcgtcctca agcgtgagcc gaaggcgctc ggcgcgctcg gcacgacgcc ggacatcgag       780
     acgctgatgg agcaggacga gccgatcatc ggcgcgggga aggtcgagga cttctcctgg       840
     aaggcgatgc tcgacttctc cacctgcacc gaatgcggcc gctgccagag ccagtgcccc       900
     gcgtggaaca ccggaaagcc gctctcgccg aagctcgtca tcatggacct gcgcgaccac       960
     ctcttcgcga aggcgccgta cctgctcggc ggtaccgaca ccgagtcgcg tgacgcggcc      1020
     tgggacgccg ctgtggccaa ggcccacgag ggtcacgacc acgccccggg cgagggccac      1080
     gaccacggcg accacgacga gcacgaggtt cacggcgttc ccgagtcggg cttcgcccgc      1140
     gtggccgagc ccggcaaggc gcaggccgag cggccgctgg tcggcaccgc cgaagagggc      1200
     ggcgtcatcg acccggacgt cctgtggtcg tgcacgaact gcggcgcctg cgtcgagcag      1260
     tgcccggtgg acatcgagca cgtcgaccac atcgtcgaca tgcggcgtta ccaggtgatg      1320
     atcgagtccg cgttcccgtc ggaagccggc gtcatgctgc gcaacctgga gaacaacggc      1380
     aacccgtggg gcgtctcccc gcgcagccgc accgagtgga ccgacggcct gccgttcgag      1440
     gtcaaggtca tcggtgaggg cgagcagatt cccgaggacg tcgagtacct cttctgggtc      1500
     ggctgcgccg gcgccatcga ggaccgggcg aagaaggtct cccgggcgtt cgccgagctg      1560
     ctcgacatgg ccggcgtgaa gttcgcgatc ctcggctcgc aggagtcctg caccggcgac      1620
     ccggctcgcc gcctgggcaa cgagtacctg ttccaggaaa tggccaaggc caacatcgag      1680
     ctgctcaacg agaccggcgt caagaagatc gtcgccacct gcccgcactg cttcaacagc      1740
     ctgtcgaagg aatactcggg cctcggcggc aactacgagg tggtccacca cacccagctg      1800
     ctcggcaagc tcgtcgagga gaagaagctg gtgccgatca ccccgatcga gtcgtcggtg      1860
     acctaccacg acccgtgctt cctcggccgg cacaacaagg tctacacccc gccccgggag      1920
     atcctggagg ccattcccgg cctgcgcggc caggagatgc accggtgcaa ggaccgcggc      1980
     ttctgctgcg gcgccggcgg cgcccggatg tggatggaag agaagatcgg cacccggatc      2040
     aacgcgaacc gggtggagga ggcgctcggc ctcgaccccg acgtcgtctc gaccgcctgc      2100
     ccgttctgca tcgtcatgct gtccgacgcc gtgaccgagc agaagctggc cggcacggcg      2160
     aaggagtccg tcgaggtcct cgacgtctcc cagctcctcg cccgctccct tgccgccccg      2220
     gccgcgccca cccaggacgc ccccggcgcg gagccggccc cgatgagctg a               2271
//

If you have problems or comments...

PBIL Back to PBIL home page