(data stored in ACNUC7421 zone)

EMBL: CP002299.PE217

CP002299.PE217       Location/Qualifiers
FT   CDS_pept        292187..294016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0217"
FT                   /product="chaperone protein DnaK"
FT                   /note="KEGG: fal:FRAAL6639 molecular chaperone DnaK;
FT                   TIGRFAM: chaperone protein DnaK; PFAM: Heat shock protein
FT                   70"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78305"
FT                   /db_xref="GOA:E3J614"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:E3J614"
FT                   /inference="protein motif:TFAM:TIGR02350"
FT                   /protein_id="ADP78305.1"
FT                   /translation="MARAVGIDLGTTNSVVSVLEGGEPTVIANAEGSRTTPSVVAFAKN
FT                   GEVLVGEVAKRQAVTNVERTIRSVKRHMGTDWKMKVDNKDFTPQQISAFILQKLKRDAE
FT                   AYLGETVTDAVITVPAYFDDAQRQATTEAGTIAGLNVMRIVNEPTAAALAYGLDKGEKE
FT                   QTILVFDLGGGTFDVSLLEIGDGVVEVKATHGDTHLGGDDWDQRITDHLIKTFQGQHGV
FT                   DLAKDKMALQRLREAAEKAKIELSQSTQTTINLPYITASAEGPLHLDVSLTRAEFQRMT
FT                   QDLIDRCKIPFQQAVKDAGIKVAQIDHVVLVGGSTRMPAVVDVVRDLTGGKEPNKGVNP
FT                   DEVVAVGASLQAGVLKGEVKDVLLLDVTPLSLGIETKGGIMTKLIERNTTIPTKRSEIF
FT                   TTAEDSQPSVQIQVFQGEREMAAYNKKLGMFELTGLPPAPRGVPQIEVTFDIDANGIVH
FT                   VSAKDLGTQKEQSMTITGGSALPKDDIEKMVRDAEQYAEEDKQRREEAETRNQGESLVY
FT                   STERFLAENGDKVEATLKADVEEKLADLRAATAGTDIAAIRTATEELGKASTAMGQSMY
FT                   AEAQAAGAAGGAAGAQADDDVVDAEIVDEEGKQ"
     atggcacgag cggtcggcat cgacctcggc accacgaact ccgtcgtgag cgtgctcgag        60
     ggtggtgagc caacggtcat cgcgaacgcc gagggctcgc gcacgacccc gtcggttgtg       120
     gccttcgcga agaacggcga ggtcctggtc ggcgaggtcg cgaagcggca ggcggtcacg       180
     aacgtcgagc ggacgatccg gtcggtcaag cgccacatgg gcaccgactg gaagatgaag       240
     gtcgacaaca aggacttcac cccgcagcag atcagcgcct tcatcctgca gaagctcaag       300
     cgcgacgccg aggcctacct gggcgagacg gtgaccgacg cggtcatcac cgtcccggcg       360
     tacttcgacg acgcgcagcg gcaggccacg accgaggccg gcaccatcgc cggcctgaac       420
     gtcatgcgga tcgtcaacga gcccaccgcc gcggccctgg cctacggcct ggacaagggc       480
     gagaaggagc agacgatcct ggtcttcgac ctcggcggtg gcacgttcga cgtgtccctg       540
     ctggagatcg gtgacggcgt cgtggaggtc aaggccaccc acggcgacac ccacctcggc       600
     ggtgacgact gggaccagcg gatcaccgac cacctgatca agaccttcca gggtcagcac       660
     ggcgtggacc tggcgaagga caagatggcg ctgcagcggc tgcgtgaggc ggccgagaag       720
     gccaagatcg agctttcgca gtcgacccag accacgatca acctgccgta catcaccgcg       780
     tcggccgagg gcccgctgca cctggacgtg tcgctgaccc gggccgagtt ccagcggatg       840
     acccaggacc tgatcgaccg ctgcaagatc ccgttccagc aggcggtcaa ggacgcgggc       900
     atcaaggtcg cccaaatcga ccacgtcgtc ctcgtcggtg gctccacccg gatgccggcc       960
     gtcgtcgacg tggtccgcga cctgaccggc ggcaaggagc cgaacaaggg cgtcaacccg      1020
     gacgaggtcg tcgccgtcgg cgcgagcctg caggccggtg tcctcaaggg cgaggtcaag      1080
     gacgtcctgc tgctcgacgt caccccgctg tccctgggca tcgagaccaa gggcggcatc      1140
     atgaccaagc tgatcgagcg caacaccacg atcccgacga agcgctccga gatcttcacg      1200
     acggccgagg actcgcagcc gtccgtgcag atccaggtct tccagggcga gcgcgagatg      1260
     gcggcctaca acaagaagct cggcatgttc gagctgaccg gcctgccccc ggcgccgcgc      1320
     ggcgtgccgc agatcgaggt caccttcgac atcgacgcga acggcatcgt gcacgtctcg      1380
     gcgaaggacc tcggcaccca gaaggagcag tcgatgacca tcaccggcgg ctccgcgctg      1440
     ccgaaggatg acatcgagaa gatggtccgc gacgccgagc agtacgcgga ggaggacaag      1500
     cagcgccgcg aggaggccga gacccgcaac cagggcgagt cgctcgtcta ctcgaccgag      1560
     cgcttcctcg ccgagaacgg cgacaaggtc gaggcgaccc tcaaggcgga cgtcgaggag      1620
     aagctggccg acctgcgcgc ggccaccgcg ggcaccgaca tcgccgcgat ccgtacggcc      1680
     accgaggagc tcggcaaggc cagcacggcg atgggccagt cgatgtacgc cgaggcccag      1740
     gccgctggcg cggccggcgg tgccgctggt gcccaggccg acgacgacgt ggtggacgcc      1800
     gagatcgtcg atgaggaggg caagcagtga                                       1830
//

If you have problems or comments...

PBIL Back to PBIL home page