(data stored in ACNUC7421 zone)

EMBL: CP002299.PE218

CP002299.PE218       Location/Qualifiers
FT   CDS_pept        294013..294699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0218"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: fal:FRAAL6640 heat shock
FT                   protein (HSP-70 cofactor)"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78306"
FT                   /db_xref="GOA:E3J615"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:E3J615"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ADP78306.1"
FT                   /translation="MSSPHNAGSAEEPPVVVRDRRRIDPRSGEVRAQAAAESAAGGESA
FT                   AAEAAAGGSGATGDAELLALIESLNLAVQERTADLQRLKAEYDNYRRRVERDRQLIAEQ
FT                   ATGRLLAGLLPTLDDIGRARDHGDLEGPFKAVAESLEVALEALGLERFGAVGDEFDPVL
FT                   HEALMHSYRGDVTAPTCVQVFRSGYSMGGRVLRVAQVAVAEPVDEPEPAEPADADAPPP
FT                   ADDTDA"
     gtgagctcgc cgcacaacgc gggctcggcc gaggaaccgc cggtcgtggt gcgcgaccgg        60
     cggcgcatcg acccacgtag cggagaggtc cgtgcccagg cggcggccga gtccgctgcc       120
     gggggcgagt cggcggcggc cgaggcggcc gccggcggct ccggcgccac cggggacgcc       180
     gagctgcttg cgttgatcga gtcgctgaac ctggcggtgc aggaacgcac cgcggacctg       240
     cagcggctga aggccgagta cgacaactac cgccgccgcg tggagcggga ccgccagctg       300
     atcgccgagc aggcgaccgg acggctgctc gccgggttgc tgcccaccct ggacgacatc       360
     ggccgcgccc gtgaccacgg cgacctggaa ggaccgttca aggcggtcgc cgagtccctc       420
     gaggtggcgt tggaggcgct cgggctggag cgtttcggcg cggtcgggga cgagttcgac       480
     ccggtgctgc acgaggcgct gatgcactcg taccgcggcg acgtcaccgc gccgacctgc       540
     gtgcaggtgt tcaggtccgg ctactcgatg ggcggccggg tcctgcgggt cgcgcaggtc       600
     gcggtggccg agccggtgga cgagccggag cccgccgaac cggcggacgc cgacgccccg       660
     ccgccagcgg acgacaccga cgcgtga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page