(data stored in ACNUC7421 zone)

EMBL: CP002299.PE223

CP002299.PE223       Location/Qualifiers
FT   CDS_pept        complement(298220..298975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0223"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dan:Dana_GF19065 GF19065 gene product from
FT                   transcript GF19065-RA"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78311"
FT                   /db_xref="UniProtKB/TrEMBL:E3J620"
FT                   /inference="similar to AA sequence:KEGG:Dana_GF19065"
FT                   /protein_id="ADP78311.1"
FT                   /translation="MMLTRIRAGWAGAAVAAVAVFTLCSCGSTVGANSATSASTAPRTA
FT                   EASVATSSKKLDPLAFVYAQGAETKSFTVTSAASAYSDLTDPDISPFRLVATCLGTTVE
FT                   PPIAAGDGVGLSLNDGEVAVNSSTQIVSPAQRARDDETLRDPRFGSCFQQTLVDWVKGA
FT                   GEPNDAVHWGEVAPRNARVPAGASARVLFALPILDNATNQQVQVMVIDVVFLSSGQIED
FT                   QLSVTSLANPANDLVLTATAQMAGKLKQQ"
     atgatgttga cccggattcg ggccggctgg gcaggcgcgg ccgtcgcggc cgtcgcggtg        60
     ttcacgctct gtagctgcgg ctccaccgtc ggcgcgaaca gtgcgacctc ggccagtacg       120
     gcgccgcgaa cggcggaagc cagcgtcgcc acgtcgtcga agaagctcga tcctcttgcc       180
     ttcgtctacg cccagggcgc cgagaccaag tcgttcacgg tgacctcggc cgcgtcggcc       240
     tactccgacc tgacagaccc ggacatcagc ccgttccggc tggtcgcgac ctgtctcggc       300
     acgacggtcg aaccgccgat cgcggccggc gacggtgttg gcctgtctct caacgacggt       360
     gaggtcgccg tcaactcgag cacgcagatc gtgtcgccgg cgcagcgtgc gcgtgatgac       420
     gagaccctgc gcgacccgcg cttcggctcc tgttttcagc agacgctcgt ggactgggtg       480
     aagggtgcgg gcgagcccaa cgacgccgtc cactgggggg aagtcgcgcc ccgcaacgcc       540
     cgcgtcccgg ccggcgcctc ggctcgcgtc ctgtttgctc tcccgattct cgacaacgcc       600
     accaaccagc aggtacaggt catggtcatc gacgtggtct tcctcagctc cgggcagatc       660
     gaggaccagt tgagcgtgac ctccttggcg aacccggcca acgacctggt gctgacggcc       720
     acggctcaga tggccgggaa gctcaagcag cagtga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page