(data stored in ACNUC7421 zone)

EMBL: CP002299.PE226

CP002299.PE226       Location/Qualifiers
FT   CDS_pept        complement(303215..303811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0226"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /note="KEGG: fal:FRAAL6635 deoxycytidine triphosphate
FT                   deaminase; TIGRFAM: deoxycytidine triphosphate deaminase;
FT                   PFAM: deoxyUTP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78314"
FT                   /db_xref="GOA:E3J623"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:E3J623"
FT                   /inference="protein motif:TFAM:TIGR02274"
FT                   /protein_id="ADP78314.1"
FT                   /translation="MLLSDRDIRAEITAGRVCLDPYDPGLIQPSSVDLRLDRAFRVFQN
FT                   HRYSHIDPAAEQEDLTELVAPEGDEPFVLHPGEFVLGSTLEVITLPDDLAGRLEGKSSL
FT                   GRLGLLTHSTAGFIDPGFSGHVTLELSNVATLPIKLWPGMKIGQLCLFRLSSPAEHPYG
FT                   AAIYGSRYQGQRGPTPSRAYRDFTRAAVPPVADQA"
     gtgttgctgt ccgaccggga catccgggcc gagatcaccg ccggccgggt gtgcctcgac        60
     ccctacgacc cgggcctgat ccagccgagc agcgtggacc ttcggctgga ccgcgccttc       120
     cgggtcttcc agaaccaccg gtacagccac atcgacccgg cggccgagca ggaggacctc       180
     accgagctgg tcgcgcccga gggtgacgag ccgttcgtgc tgcacccggg cgagttcgtg       240
     ctcggctcca ccctcgaggt catcacgctc ccggacgacc tggccggccg gctcgagggc       300
     aagtccagcc tgggccggct gggcctgctg acccactcga ccgcgggctt catcgacccg       360
     ggcttctccg gccacgtgac gctggagctc tccaacgtcg cgacgctgcc gatcaagctc       420
     tggccgggta tgaagatcgg ccagctctgc ctgttccggc tgtcctcgcc ggccgagcat       480
     ccctacggcg ccgcgatcta cggctcccgc taccaggggc agcgcgggcc gaccccgtcc       540
     cgcgcctacc gtgacttcac ccgcgccgcg gtgcccccgg tcgccgacca ggcctga          597
//

If you have problems or comments...

PBIL Back to PBIL home page