(data stored in ACNUC7421 zone)

EMBL: CP002299.PE230

CP002299.PE230       Location/Qualifiers
FT   CDS_pept        309499..309738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0231"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lrl:LC705_02817 predicted ORF"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78318"
FT                   /db_xref="UniProtKB/TrEMBL:E3J627"
FT                   /inference="similar to AA sequence:KEGG:LC705_02817"
FT                   /protein_id="ADP78318.1"
FT                   /translation="MNDELPTVMLRLWLADAIVLFDWLSNTDLNLVPITHPAQKQALAD
FT                   LQSRMEWDIDTDLENVTDEEIAAAQAEVARDMGW"
     gtgaatgacg agctgccgac ggtgatgctg cgcctgtggc ttgccgatgc catcgtgttg        60
     ttcgactggt tgagcaacac ggacctgaac ctggtgccga tcactcatcc ggcccagaag       120
     caggcgctgg cagatctgca gtcgcgcatg gagtgggaca tcgacaccga tctcgaaaac       180
     gtcaccgacg aagagatcgc ggcggcgcag gcagaggtgg cccgagacat gggctggtag       240
//

If you have problems or comments...

PBIL Back to PBIL home page