(data stored in ACNUC7421 zone)

EMBL: CP002299.PE232

CP002299.PE232       Location/Qualifiers
FT   CDS_pept        310832..312220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0233"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: app:CAP2UW1_4401 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78320"
FT                   /db_xref="GOA:E3J629"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:E3J629"
FT                   /inference="similar to AA sequence:KEGG:CAP2UW1_4401"
FT                   /protein_id="ADP78320.1"
FT                   /translation="MLEKPAILRRLIARYGALRELDGYTPQSRGVEFNRLLAEVLDCYG
FT                   ISAKSSVRGQGEIDVAFSINGTRFILEAKWEEEKTDYGKIAKLQGRVRQRLVTTVGVFA
FT                   SMSGYTDDALSIGIGGRLDVLLLDRRHLEAMISGVVPPDELFDLLIDKTSYEGGVFHDL
FT                   EDLFPSPAGDPQLKFGCPDDLQGRLVRSAREGITAEVVAHDLPMSYFGMALDSAGRLIL
FT                   NYPEGLVRVDLERGRARWMAPFTKCYLHVLPTAAGDILFGRMYGVGSLSGGRLRALAGG
FT                   FAGNAILFSDDEGHARALDNGGVRDWSPEFPGEANVSLALIGENLGDERWTATDVPGAT
FT                   VGGATWAHSGKVAAVGSSALEMIDAASGARTSFQHDLTNTFSVVSYDDNRVLVVADGRS
FT                   LAVIDVAAKTSTVLLELELNGSVSELSRASGEVFYLLSTYGEGPTKQPRAIVVRISLPS
FT                   ALTV"
     atgcttgaga aaccggccat tctccgcagg ctaattgcgc gctacggggc attgagggaa        60
     ctcgatgggt acacgcctca atcgcgaggt gtcgagttca atagactact cgcggaggtg       120
     ctcgattgct acgggatatc cgccaagtca tctgttcgcg ggcagggtga gatcgatgta       180
     gccttttcaa tcaacggaac tcggttcata cttgaggcga aatgggagga ggagaagacg       240
     gactatggaa agatcgccaa gctgcagggt cgggttaggc agcggctggt gacaacggtc       300
     ggtgttttcg catcgatgtc cggctacact gatgacgcgc tgagtatcgg catcggggga       360
     cgactagacg tccttcttct ggatcgccgg cacctggaag caatgatttc cggtgttgtt       420
     ccgccagacg agcttttcga tctactgatc gataagactt cctacgaggg tggagtcttc       480
     catgatcttg aagatctctt cccgtcaccg gcgggagatc cgcagctgaa atttggctgc       540
     cccgacgacc tgcagggcag actggtaaga tcggcgcggg aaggaatcac tgcagaggtc       600
     gtcgcacacg atttaccgat gtcttacttc ggaatggccc ttgattctgc tgggcgtcta       660
     attctaaact acccagaagg gctggtcagg gtcgacctgg agcggggccg ggcaagatgg       720
     atggcaccat ttactaagtg ctatcttcac gtgcttccga ctgcggcagg cgatatcctg       780
     tttgggcgaa tgtacggcgt cggaagcctc agcggtggtc gattgcgggc gctcgctggc       840
     gggtttgcgg gcaatgcaat tttgttttcc gacgatgaag gccacgcgcg tgcacttgac       900
     aatggcggcg ttcgagattg gtctccggag tttccgggcg aagcgaatgt ttcccttgcg       960
     ctgatcgggg agaatcttgg tgacgagagg tggacggcta ctgacgtccc gggtgcaacc      1020
     gtcggtggtg ctacctgggc tcactctggg aaagttgctg cggttggttc ctcggcactc      1080
     gaaatgatcg acgcagcttc aggcgccagg acgtcgttcc aacacgacct caccaacacc      1140
     ttcagcgtcg tcagctacga cgacaaccgt gtactggtcg tggctgacgg tagatcgctt      1200
     gcagtgatcg atgtagccgc taaaacctca acggtactac ttgagctgga gctgaatggg      1260
     agcgtctcgg agttgtcgag ggcatcaggc gaggttttct acctactgtc gacctacggg      1320
     gaggggccta cgaagcaacc gcgcgcaatt gttgtacgaa tttcgttgcc gtcggcgctg      1380
     acggtctaa                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page