(data stored in ACNUC7421 zone)

EMBL: CP002299.PE234

CP002299.PE234       Location/Qualifiers
FT   CDS_pept        complement(313314..314477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0236"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   sfu:Sfum_4009 radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78322"
FT                   /db_xref="GOA:E3J631"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E3J631"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADP78322.1"
FT                   /translation="MPYRLIASPFLDHHLLVTPGSNQGVKISPDRYQALQTLDTEDGDV
FT                   PVWLTAAAKQRWGIDLAGAIAGSVLVRQPTALNYGRASHEVNLGCNYDCEHCYLGLKKF
FT                   DGLEWDDRVRLLHTIRDAGVLWLQLTGGEPMIDRHFSDVYALAFDLGMMIDVLSNGSRL
FT                   ANPGILDLLTRRPPHRITLSIYGATEASYDGLTRRRGAFKAFSAGLAAAHEAGIPMDLS
FT                   IGVTRSNAHEVDQMRALADRYGLPHSLYGNISPTIYGGAEVLASQAPEILGPRTPFTGC
FT                   NAGHTFFHVDPFGKASICKVGREPNIPLLDEGLDGLARLGTIADGLLQRQGGCTGCTLQ
FT                   GTCGTCMPLVTLFRKANAPLRNYCQHKETPHGRRQLHVVHPDRAATH"
     atgccatacc ggctgatcgc aagcccattt ctcgatcacc atctgttggt aaccccgggc        60
     agcaaccagg gcgtgaagat cagtccagac cgctatcagg cacttcagac gctcgacacc       120
     gaggatggtg acgtccccgt ctggttgacg gcagccgcaa agcaacggtg gggcatcgac       180
     cttgccgggg ccatcgccgg atcggtcctc gtccgtcaac ccacggcgct gaactacggc       240
     cgggcatccc atgaggtcaa cctcggttgt aactatgact gtgagcactg ctacctggga       300
     ctgaagaagt tcgacgggct cgaatgggac gaccgcgtcc ggctactgca caccatccgg       360
     gacgccggag tcctctggct tcagctcacc ggcggcgaac cgatgatcga ccgccatttc       420
     tccgacgtct acgccctggc attcgacctc ggcatgatga tcgacgtcct gtcgaacggc       480
     tcacgactcg cgaatccggg catcctcgac ctgctcaccc gccgcccgcc gcaccggatc       540
     accctgagca tctacggcgc gaccgaggcg agctacgacg gactcacccg ccgccgggga       600
     gcgttcaagg cgttctccgc aggtctcgca gccgcgcacg aggccggtat ccccatggat       660
     ctcagcatcg gcgtcacccg cagcaacgca cacgaagtcg accagatgcg tgcgctcgcc       720
     gaccgctacg gcctcccgca cagcctgtac ggcaacatct ccccgacgat ctacggcggc       780
     gccgaggtgc tcgccagcca ggcccccgag attctcggtc cacgcacacc gttcaccggc       840
     tgcaacgcgg gacacacgtt cttccacgtc gacccattcg gcaaagccag catctgcaag       900
     gtcgggcgcg aaccgaacat cccgctcctt gacgaagggc tcgatgggct cgcccgactc       960
     ggcaccatcg ccgacgggct cctccaacgg cagggtggct gtactggctg caccctgcag      1020
     ggcacctgcg gcacctgcat gccgctggtc accctgttcc gcaaggccaa cgcgccgctg      1080
     cggaactact gccagcacaa ggaaaccccc cacggaagga gacagctcca tgtcgtccac      1140
     ccagaccgcg ccgccaccca ctga                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page