(data stored in ACNUC7421 zone)

EMBL: CP002299.PE235

CP002299.PE235       Location/Qualifiers
FT   CDS_pept        314672..315931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0237"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: XRE family transcriptional regulator; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78323"
FT                   /db_xref="GOA:E3J632"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E3J632"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADP78323.1"
FT                   /translation="MDAGDRPISGNLRDLRRTAGLSQEELAGRTGLSVSTVRKVEQGGS
FT                   ARVETLHVLARALGVETSALFGSQAPKPADAEEENKLNLVAFRHALTPAVGFGGSTRRV
FT                   DGLVAAGIERESLGRDLRAAVTRYHADDFEGVARGLPRMVAATNELVRQSAGDEVASLA
FT                   AQRLRSDVLQLAGWFLTQVRQYDLAYVALRDAVADGESSDDRLSVAASVISQCWLFIRQ
FT                   GRFSDAELLAGDAATQIEPRMSEASKEELAAWGWLLLRGSAAAIRNNRSDESREFLRLA
FT                   EVAAVRHDGQPRRMAAGYHQYWSTFDVSTVRMKIAEALMIDGDASGVLRVAEGVQAPRR
FT                   AGRSDNYSRHLLDVAGAHAALRNYQDAIDILSSLRSTTPDWLRHQRRAGDLVGGLVTSR
FT                   KRRVGQDLRELAGFFGSTGS"
     gtggacgctg gcgaccgccc gatcagcggc aacttgcggg acctgcgccg gactgccggt        60
     ctgtctcaag aggagttggc gggacgcact ggcctgagcg tgtcgacggt ccggaaggtc       120
     gaacagggtg gatcggcccg ggtcgagacg ctgcacgtgc tggcgcgtgc gcttggtgtc       180
     gagacgtcgg ccctgttcgg tagccaggcg cccaagcccg cggacgccga agaggaaaac       240
     aagctcaacc tggtggcgtt ccgccatgcg ctcacgcccg ccgtcggatt cggcgggtcg       300
     acgcggcgcg ttgatgggtt ggtggcggcg ggcatcgagc gggagtcgct cgggcgtgat       360
     ctccgcgcgg cggtcactcg ttaccacgcg gacgacttcg agggcgtagc tcgcgggctt       420
     ccccggatgg tggctgccac gaacgagctg gtcaggcaat cggccggcga tgaggtcgcg       480
     tcgctggcgg ctcagcgact gcgttcggat gtgctgcaac tggcaggctg gtttctgacc       540
     caggtacgcc aatacgatct tgcatacgtg gcgctgcggg atgcggtggc tgacggcgaa       600
     tcgtcggacg accggttgtc cgtggcggcg agcgtgatct ctcaatgctg gttgttcatc       660
     cgacagggcc ggttctcgga tgcggagctt ctggccggcg atgctgcgac gcagatcgaa       720
     ccgcgcatgt ccgaggcctc gaaagaggag ctggccgcct ggggctggct gctgttgcgt       780
     gggtctgctg cggccatccg caacaatcgt tcggacgaat cgcgtgagtt cctgcggctg       840
     gcagaggtgg cggccgtccg gcatgacggt caaccgcgtc ggatggcggc cggctatcac       900
     cagtactgga gcacgttcga cgtgtccacg gtgcgcatga agatcgcgga agccctcatg       960
     atcgatgggg acgcttccgg cgtgcttcgg gtcgccgaag gtgtccaggc tccgaggcgg      1020
     gcggggcggt cggacaacta cagccggcac ctgctggatg ttgccggtgc gcacgctgcg      1080
     ctgcggaact accaggacgc catcgacatc ctgtccagcc tgcggtcaac gacgccggac      1140
     tggcttcgcc accagcggcg tgccggcgac ctggtcggcg ggctcgtgac ctcccgcaag      1200
     cggcgcgtcg gccaggacct ccgggagctg gcgggcttct tcggtagcac agggtcatag      1260
//

If you have problems or comments...

PBIL Back to PBIL home page