(data stored in ACNUC7421 zone)

EMBL: CP002299.PE24

CP002299.PE24        Location/Qualifiers
FT   CDS_pept        complement(29259..29618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0024"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL5453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78112"
FT                   /db_xref="UniProtKB/TrEMBL:E3J274"
FT                   /inference="similar to AA sequence:KEGG:FRAAL5453"
FT                   /protein_id="ADP78112.1"
FT                   /translation="MPTIKLMGAAEIAQLLDVSPSRVHQILRDDSAFPEPVAVLSMGKV
FT                   WSAEDVERWNAARKAPRPARDQAERWTLDDLQQALERYEQLLVSGGKSSTTVQTSVDRP
FT                   RRFLRWLAGDYDPLA"
     atgccgacga tcaaactcat gggtgccgcg gagatcgcgc agctcctgga cgtgagcccg        60
     tcgcgggtcc atcagatcct tcgcgacgac tccgcgtttc ccgagcccgt ggccgtgctg       120
     agcatgggga aggtgtggag cgccgaggac gtcgagcgat ggaacgccgc ccgcaaggcg       180
     cccaggccag ccagggatca ggccgagcga tggacccttg acgatctcca gcaggcgctg       240
     gagcggtacg agcagcttct ggtgtccggt gggaagtcgt cgacgacggt tcagacctct       300
     gtcgaccgtc cgcgccggtt cctgcggtgg cttgccggcg actacgaccc gctggcctag       360
//

If you have problems or comments...

PBIL Back to PBIL home page