(data stored in ACNUC7421 zone)

EMBL: CP002299.PE242

CP002299.PE242       Location/Qualifiers
FT   CDS_pept        complement(321687..323645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0244"
FT                   /product="asparagine synthase"
FT                   /note="PFAM: asparagine synthase; KEGG: fal:FRAAL4922
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78330"
FT                   /db_xref="GOA:E3J639"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E3J639"
FT                   /inference="protein motif:PFAM:PF00733"
FT                   /protein_id="ADP78330.1"
FT                   /translation="MTHPLTTPAPLATAAPWFVVLPDTPAGAALAGTLQAADPTIAALR
FT                   RPSGRPWLIGRWAGDEIVDAVAGRSRMALLGCAPISHDRLAARLASARDLGALDQVALE
FT                   LPGSFHLVAEIEGCQRVQGTASGLRRVYHAALGGEAGIIAGDRADVVAALADLDRIDVG
FT                   AVLLCLVDPVAPHPLDDRPLWQGLTAVPPDHWLCVEQGHPSHRRWWLAPEPTLDGAEGA
FT                   AALRQALVTAVAARTAAGGTVTADLSGGLDSTALCFLAATGPAALVPYTGLGRDPADDD
FT                   ARWAALARAALGVETFEMLPRDRLPLVYEGITEVEEPLDRPFIGVIDRAKLLAGLRLAA
FT                   RHGPRLHLCGLGGDEVAESMPNYLAGLALGHPLAAWARLRPLRAQSRWPLAATLRTLRP
FT                   RSYRDWLAALARPAGGPPARGRRHLVPPERVAELDWSMPPRIGAWLTPDATELLRATIE
FT                   QAAATAEPLGPTRDRHGDLFAIRVGAAVARGFAQLAAPTGPPLAAPFYDDRVIEAALAV
FT                   RPEERSTPWEYKPLLKAAMAGLVPTACLRRETKAECSAEEEAGLRAHQTALRGLFDGSR
FT                   LAELGLVDTDRLLGLCRYSAAPDRHYLALQQTAAAESWLRAAGRRPSSGGPPHQSARPA
FT                   TVPAAGSPEPEPLERTC"
     atgacccacc cgttgaccac gccagcgccg ctggccacgg ccgccccctg gttcgtcgtc        60
     ctgccggaca ctccggcggg cgccgccctg gccggcaccc tccaggccgc ggatccgacc       120
     atcgcggcgc tgcgccgacc gtccggccgt ccctggctga tcggccgctg ggccggcgac       180
     gagatcgtcg acgcggtcgc cggccggtca cggatggccc tgctcggctg cgccccgatc       240
     agccacgacc ggctcgccgc ccggctggcc agcgcccgcg acctcggcgc gctcgaccag       300
     gtcgccctcg aactgccggg cagcttccac ctggtggccg agatcgaggg ctgccagcgg       360
     gtccagggca ccgcgtccgg cctgcgccgc gtctaccacg ccgcgctcgg cggcgaggcc       420
     gggatcatcg ccggcgaccg agcggatgtc gtcgccgcgc tcgccgacct cgaccggatc       480
     gacgtcggcg ccgtcctgct ctgcctggtc gacccggtcg cgccgcaccc gcttgacgac       540
     cgcccgctgt ggcagggcct cacggccgtg cccccggacc actggttgtg cgtcgagcag       600
     ggccacccca gccaccgacg ctggtggctg gcgcccgaac cgacactcga cggcgccgag       660
     ggcgcggcgg cgctgcgcca ggcgctggtc accgctgtgg cggcccgcac ggccgccggc       720
     gggaccgtca ccgcggatct ttccggcggg ctcgactcga cggcgctgtg cttcctggcc       780
     gccaccgggc cggccgcgct cgtcccgtac acgggcctgg gccgcgaccc ggccgacgac       840
     gacgcgcgct gggcggcgct cgcccgggcg gcgctgggcg tcgagacctt cgagatgctg       900
     ccgcgcgacc ggctcccgct cgtctacgag ggcatcaccg aggtcgagga gccgctcgac       960
     cggcccttca tcggggtgat cgaccgggcg aagctgctcg cggggctgcg gctggccgcc      1020
     cgccacggac cgaggcttca cctgtgcggc ctcggcggcg acgaggtcgc ggagagcatg      1080
     ccgaactacc tcgcgggcct ggccctcggc catccgctgg ccgcctgggc ccggctgcgg      1140
     ccactgcgcg cgcagagccg ctggccgctc gccgcgacgt tgcggacgct gcggccgcgg      1200
     tcctaccggg actggctggc ggccctggcc cgaccggccg gtggaccgcc ggcgcgcggc      1260
     cggcgccacc tggtgccgcc ggagcgggtc gccgagctgg actggtcgat gccgccgcgg      1320
     atcggcgcgt ggctgacgcc cgacgccacc gagctgctgc gcgcgacgat cgagcaggcg      1380
     gccgcgacgg ccgagccgct cggaccgacg cgcgaccggc acggcgacct gttcgcgatc      1440
     cgggtcgggg cggccgtggc tcgcgggttc gcgcagctgg ccgcgccgac gggaccgcca      1500
     ctggcggcac cgttctacga cgaccgggtg atcgaggccg ccctcgcggt ccggcccgag      1560
     gagcgctcca cgccgtggga gtacaagccg ctgctcaagg ccgcgatggc cggactggtg      1620
     cccaccgcgt gcctgcggcg cgagaccaag gcggagtgct cggccgagga ggaggccggc      1680
     ctgcgcgcgc accagacggc gctgcgcggg ctgttcgacg gatcccggct ggccgagctc      1740
     gggctggtcg acaccgacag gctgctggga ctctgccgct attcagcggc acccgaccgt      1800
     cactacctgg cgctgcagca gaccgccgcc gccgagtcct ggctgcgcgc cgctggccgc      1860
     cggccatcct caggcggccc gccccaccag agcgcccgcc cggcgaccgt cccggccgcc      1920
     ggcagtcccg agcccgagcc gctggagagg acatgttga                             1959
//

If you have problems or comments...

PBIL Back to PBIL home page