(data stored in ACNUC7421 zone)

EMBL: CP002299.PE244

CP002299.PE244       Location/Qualifiers
FT   CDS_pept        complement(324495..325316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0246"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="PFAM: transcriptional activator domain;
FT                   transcriptional regulator domain-containing protein; KEGG:
FT                   fal:FRAAL4923 putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78332"
FT                   /db_xref="GOA:E3J641"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E3J641"
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /protein_id="ADP78332.1"
FT                   /translation="MDVDVEPGTGVVRFAALGPLELLAADGAPVFIGQRKKRRLLALLL
FT                   LHAGGWVSTEQIAVALWEDDPPRSALGNIKTYVSELRRALPPASGDRTDGHDADPGSPF
FT                   GRILSRDGEYLLRLAPNEFDIELFDAGACAGEEALAAGRPAEATVLLDRALALWRGQPY
FT                   DDLPADIAVAETSRLDELRWAVWENLVDARLRLGQHNRVLPALRALTIQHPTRERLWAQ
FT                   LLAALGQDGRRAEALNAYQTVYRMLTERLGIEPGEDLRLEHQRILNGDQHR"
     gtggacgtgg acgtggagcc gggtacgggc gtcgtccggt tcgcggcgct ggggccgctg        60
     gaactgctgg cggcggacgg ggcgccggtg ttcatcgggc agcgcaagaa gcgccgcctg       120
     ctcgcgctgc tcctgctgca cgcgggcggc tgggtgagca ccgagcagat cgccgtcgcg       180
     ctgtgggagg acgacccgcc gcgctcggcc ctcggcaaca tcaagaccta cgtctcggag       240
     ctgcgtcggg cgctgccgcc ggcctccggc gaccggaccg atggccatga cgccgatccg       300
     gggtctccgt tcggccggat cctcagccgc gatggcgagt acctgctgcg cctggcgccg       360
     aacgagttcg acatcgagct gttcgacgcg ggcgcgtgcg cgggcgagga ggcgctggcc       420
     gccggccgac cggccgaggc gacggtgttg ctcgaccggg cgctcgcgct ctggcgcggc       480
     cagccgtacg acgacctgcc ggcggacatc gccgtcgccg agaccagccg gctcgacgag       540
     ctgcgctggg cggtctggga gaacctggtc gacgcccgac tgaggctggg ccagcacaac       600
     cgggtgctgc ccgccctgcg tgccctgacg atccagcatc cgacgaggga gcggctgtgg       660
     gcccagcttc tcgcggcgct gggccaggac ggccggcgtg ccgaggcgtt gaacgcctac       720
     cagacggtct accggatgct caccgagcgg ctgggaatcg agccaggcga ggacctccgg       780
     ctggaacacc agcgcatcct gaacggggat cagcacaggt ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page