(data stored in ACNUC7421 zone)

EMBL: CP002299.PE245

CP002299.PE245       Location/Qualifiers
FT   CDS_pept        325619..326518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0247"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="PFAM: glutamine amidotransferase class-II; KEGG:
FT                   fal:FRAAL6624 putative glucosamine--fructose-6-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78333"
FT                   /db_xref="GOA:E3J642"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E3J642"
FT                   /inference="protein motif:PFAM:PF00310"
FT                   /protein_id="ADP78333.1"
FT                   /translation="MCQMFALTSGSQPVEATFWLLDSPDSERALSARVPDGAGLATFGE
FT                   DRAPRIVKQPISSRAGADFAYQPRTVVSSTFIAHVRHASTGRTSLANTHPFQHAGRVFA
FT                   HNGVIEELDRLDDQLGEYRGLVQGDTDSERYFALINREIDAQGGDVGAGIVAAARWIAA
FT                   NLPLYSINMVMATADELWALRYPDTNRLYVLSREPGGQNSRHLDHASPFSEIRARSLDL
FT                   ADRPAVAVESERMDEDPAWRLMASGELLHVAADLTVTSRVVISIPPARQLSLDDLSPEA
FT                   AFSQVVNVAPAETTPTSA"
     atgtgccaga tgttcgcgct gaccagcggc tcgcagcccg tagaggcgac gttctggttg        60
     ctcgactcgc ctgacagcga acgcgcgctc tctgcccgcg tgcccgatgg tgcgggcctt       120
     gcgacgtttg gggaggatcg ggcccctcgg atcgtgaagc agccgatctc aagccgggcc       180
     ggggccgact tcgcctacca gccgcgaacc gtcgtctcat cgaccttcat cgcccatgtc       240
     cgacacgcgt cgaccgggcg gacgagcctc gcgaacaccc atccgttcca gcacgccggc       300
     cgggtgttcg cgcacaacgg cgtcatcgag gagctggacc ggctggacga tcagctcggc       360
     gaataccgcg ggctcgtcca gggcgacacc gactcggagc gctacttcgc cctgatcaac       420
     cgggagatcg acgcccaggg cggtgatgtc ggagcgggca tcgtcgctgc cgcccgctgg       480
     atcgcggcca acctgccgct ctactcgatc aacatggtga tggcgaccgc cgacgagctg       540
     tgggcactgc gctacccgga caccaaccgg ctctacgtgc tcagccgcga gcccggcggc       600
     cagaacagcc gccacctcga ccacgcgagc ccgttcagcg agatccgggc ccgttcgctc       660
     gacctcgccg accgcccggc tgtcgccgtc gaaagcgagc ggatggacga ggacccggcc       720
     tggcgcctga tggcctccgg cgagctcctg cacgtcgccg ccgacctgac ggtcacgtct       780
     cgggtcgtga tctcgatccc gcccgcccgt cagctctccc tcgacgacct cagccccgag       840
     gccgcgttct cccaggtcgt caacgtcgcc cccgccgaga cgacccccac atctgcctga       900
//

If you have problems or comments...

PBIL Back to PBIL home page