(data stored in ACNUC7421 zone)

EMBL: CP002299.PE246

CP002299.PE246       Location/Qualifiers
FT   CDS_pept        complement(326827..328473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0248"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: gbr:Gbro_1190
FT                   integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78334"
FT                   /db_xref="GOA:E3J643"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:E3J643"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADP78334.1"
FT                   /translation="MNVKTEKRCGCRDPETKKKYPRGGCPRIEDRGHGTWAWRIWVPSE
FT                   LVPLVGKKEISGSGCRTKRDAEKAADEAVGNIRAGQQHVGRLTVGQYLDEWLEGKRRLR
FT                   PSARRTYESHLRVHLKPWLGKVPLVGLRADHIDKAFRQIEAAGASKPQPTGPATIERIR
FT                   DTLRNALNDAVDRRLIPFNPVRGVELPEYSQPEIEPWEAHEVGTFLDEASTDRLAAMWE
FT                   LIGLHGVRRGEACGASWPGLDTERSVLTIGQQITESGGQHGVWAPKTRSGRRKVDLDST
FT                   TLGSLLAHRIAQDSERDDIGPAWDNGTLPNEHGEPVHLEGLIFTRPDGQYLRPGYVSAR
FT                   MQVIARRAGLLGAVRAAAQAEARTLAVGVRQRDIDPRGTWTLYVDRVPVGEVTVTGVTR
FT                   LRGNGALLDLAVPLAGDVPARAELGRGLLSRRRLHDLRHSSASIQLSEGIDLALVSKRL
FT                   GHSSPAITGALYAHLLRPAGQRAAETVAKAVPRSARSGHPLGTDAVLGSGDASPRQSGE
FT                   ANLLVESGGRGIRTHDEVAPIAVFKTAAIGH"
     gtgaacgtca agacggagaa gcgctgcggg tgccgcgatc ccgagacgaa gaagaagtac        60
     ccgcgcggtg gctgcccgcg gatcgaggat cgcgggcacg gcacgtgggc ctggcggatc       120
     tgggtgccca gcgaactcgt gccgctggtc ggcaagaagg agatcagcgg atccggctgc       180
     cggacgaaaa gggacgccga gaaagcggcc gatgaggccg tcgggaacat ccgcgccggt       240
     cagcagcacg ttggccggct gaccgttggc cagtacctcg acgagtggct ggagggtaag       300
     cgccggctac ggccgagcgc ccgccgcacc tatgagagcc acctgcgcgt gcacctcaag       360
     ccgtggctgg gcaaggtgcc gctggtgggc ctgcgggccg accacatcga caaggctttc       420
     cggcagatcg aggccgccgg cgcgagcaag ccccagccga ccgggccggc gacgatcgag       480
     cggatccggg acacgctccg caacgcactg aacgatgccg tggaccgacg cctgatcccg       540
     ttcaatccgg tccgcggggt cgagctgccg gagtacagcc agcccgagat cgagccctgg       600
     gaagcgcacg aggtcggcac gttcctcgac gaggcatcga ccgaccggct cgccgcgatg       660
     tgggaactga tcggcctgca cggcgtgcgc cgcggcgagg cctgcggcgc gtcctggccc       720
     ggcctggaca ccgagaggtc ggtcttgacg atcggccagc agatcaccga gtcgggcggg       780
     caacacggcg tgtgggcgcc caagacgcga tccgggcggc gcaaggtcga cctggactcc       840
     acgacgctcg ggtcgctgct cgcacaccga atcgcgcagg acagcgaacg ggacgatatc       900
     ggcccggcct gggacaacgg caccttgccc aacgagcacg gcgagccggt gcacctcgaa       960
     gggctgatct tcacccggcc ggatggccag tacctgcggc cgggctacgt gtcggcgcgc      1020
     atgcaggtga tcgctcggcg ggccggcctg ctcggcgcgg tccgggcggc ggcccaggcc      1080
     gaggcgcgga ccctcgccgt cggcgtccgc cagcgcgaca tcgatccgcg cggcacgtgg      1140
     acgctgtacg tcgaccgtgt gccggtcggc gaggtgaccg tgaccggggt gacccggcta      1200
     cgtggcaacg gcgcgctcct ggacctggcc gtcccgctcg ctggcgacgt gccggcccgc      1260
     gcggagctcg gccgcggcct gctctctcgc cggcggctgc acgaccttcg ccattcgtcc      1320
     gcgtcgatcc agctttccga gggcatcgac ctggcgctcg tgtccaagcg cctcggtcac      1380
     tcttcgccag cgatcacggg tgcgctgtac gcgcatctgc tgcgcccggc gggccagcgg      1440
     gcggccgaga cggtagccaa ggcggtgccg cgctccgcgc gctctgggca ccctctgggc      1500
     accgacgccg ttctgggctc cggcgacgct tcgccgcggc agtctggcga ggcaaacctg      1560
     ctggtagaga gcggagggcg tgggattcga acccacgatg aggttgcccc catagcagtt      1620
     ttcaagactg ccgccatcgg ccactag                                          1647
//

If you have problems or comments...

PBIL Back to PBIL home page