(data stored in ACNUC7421 zone)

EMBL: CP002299.PE247

CP002299.PE247       Location/Qualifiers
FT   CDS_pept        complement(328470..329240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0249"
FT                   /product="Xre family DNA-binding protein"
FT                   /note="KEGG: rer:RER_33300 Xre family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78335"
FT                   /db_xref="GOA:E3J644"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:E3J644"
FT                   /inference="similar to AA sequence:KEGG:RER_33300"
FT                   /protein_id="ADP78335.1"
FT                   /translation="MTQDAAPRPLREVVGEAARKIRETAKRRQDDVARGARLMGLPWSR
FT                   AKVGALENGAKAVSVEELVTLALVLTQVCGRTIRVPDLLDADDLVILTPHLQVPAREVA
FT                   KSLAGQNSLGALDPAIALTPAGHKAVLAEVESLAREKRANAELFLLVTRIQRLGLKGDL
FT                   DAWAAEIGEAEQKTARRLDEPAVVLVALSHELWGRTLSEERDRVADEREPDASPDRRRA
FT                   LRGQVTRALVNELAAELARRDHIAAPVGTDGTDR"
     atgacgcaag acgcggcccc ccgcccgctc cgcgaggttg taggcgaggc agcacgcaag        60
     atcagggaga cggcaaagcg ccgccaggac gacgtggccc gtggcgcccg cctgatgggc       120
     ctgccttggt cgcgcgcgaa ggtcggggcg ctcgagaatg gcgcgaaggc cgtcagcgtg       180
     gaggagcttg tcacgctcgc cctcgtgttg acgcaggtct gcggacgcac catccgcgtg       240
     ccagacctgt tggacgcgga cgacctcgtg atcctcaccc cccacctgca agtaccagcg       300
     cgcgaagtcg cgaagtcgct cgcaggccaa aacagcctcg gagcgctcga ccctgcgatt       360
     gcccttaccc cggcgggaca caaggccgtt ctcgctgagg ttgagagctt ggcccgggag       420
     aagcgcgcga atgcagagct gtttctcctc gtgacgcgca tccagcgtct tggcctcaag       480
     ggtgacctag acgcctgggc ggcagagatc ggcgaggccg aacagaagac cgcccggagg       540
     ctggacgagc ccgcagtcgt tctcgtggcg ctctctcacg agctttgggg acggactctc       600
     tctgaagagc gcgaccgggt ggcagacgag cgcgaaccag acgccagccc cgaccggcgg       660
     cgggcactac ggggccaggt gacgcgcgct ctggttaacg agcttgcggc cgagctggca       720
     cggcgggatc acatcgcggc gccggttggc acggatggga ccgaccggtg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page