(data stored in ACNUC7421 zone)

EMBL: CP002299.PE249

CP002299.PE249       Location/Qualifiers
FT   CDS_pept        329566..329946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0251"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sna:Snas_5423 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78337"
FT                   /db_xref="UniProtKB/TrEMBL:E3J646"
FT                   /inference="similar to AA sequence:KEGG:Snas_5423"
FT                   /protein_id="ADP78337.1"
FT                   /translation="MNLASDPLAAATPGGRAEGGRVTAADLDSRRLANLTTPPAPHLTR
FT                   AEARRIRRAALAELRGRWPIDRLRALPATTDLATAGSILGMAEDKARELARAGDFPAPL
FT                   IRHGDRYVVPTRPLLALLGIDR"
     gtgaacctcg cctccgaccc cctggccgcg gcgacgcctg gcggccgagc agaaggcggg        60
     cgcgtgactg ccgccgatct tgactcacgg cgcctggcca acctcacgac gccgcccgcg       120
     ccgcacctca cgcgcgccga ggctcgacgg atacgccggg ccgcgctggc cgagctgcgc       180
     ggacgctggc ccatcgatcg gcttcgcgcc ctgccagcga ccaccgactt ggccacggcc       240
     gggtccatcc tcggcatggc ggaggacaag gcccgcgagc tggcccgcgc cggcgacttt       300
     cccgcgccgc ttatccgcca cggcgaccga tacgtggtgc ccacccggcc gctcctggcc       360
     ctcttgggca tcgaccggtg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page