(data stored in ACNUC7421 zone)

EMBL: CP002299.PE251

CP002299.PE251       Location/Qualifiers
FT   CDS_pept        330909..331583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0253"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; KEGG:
FT                   stp:Strop_4005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78339"
FT                   /db_xref="GOA:E3J648"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J648"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ADP78339.1"
FT                   /translation="MTTLDRTIRLGGAVARCGQLRIPTGVAPAADPIPTGETPEDVTAR
FT                   LAAQAAGRLARYRRQRPAAYAAASLGDLGPNERAAIWRWLESDSLTLVITGPVGTGKTH
FT                   AAFAAANWAAGQGTIPAAWTVPDLMVDLAPEGDPSAAHVTRTAPLLLLDDLGVEKTSEW
FT                   RVEQITALIDNRLGNGLRQIVTANADYDALARRYGERAMSRLTARAGLVRLTGADRRRV
FT                   TW"
     atgaccaccc tcgaccgcac gatccgcctc ggcggcgcgg tcgcccgctg cggccagcta        60
     cgcatcccga ccggcgtggc gccggccgcc gaccccatcc cgacgggcga gacacccgag       120
     gacgtcacgg cccggcttgc cgcccaggcc gccggccggc tcgcccgcta ccgccgccag       180
     cggcccgccg cgtacgccgc cgccagcctc ggcgacctcg gccccaacga gcgcgccgcc       240
     atctggcgct ggctcgaatc ggactcgctc accctggtca tcaccggacc cgtcggcacc       300
     ggcaagaccc acgccgcgtt cgccgccgcc aactgggccg ccgggcaggg caccatcccc       360
     gcagcgtgga ccgtgcccga cctcatggtc gacctggcgc ccgagggcga cccgtccgcc       420
     gcgcacgtga cccgtaccgc cccgctgctc ctgctcgatg acctcggcgt cgagaagacg       480
     tccgagtggc gcgtcgagca gatcacggca ctgatcgaca accgactggg taacggcctc       540
     cgccagatcg tgaccgcaaa tgcggactac gacgccctgg cgcggcgcta cggcgaacgg       600
     gcgatgtcga ggctcaccgc gcgggccgga ctcgtacggc tgacgggcgc cgaccggcgc       660
     cgagtgacct ggtga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page