(data stored in ACNUC7421 zone)

EMBL: CP002299.PE252

CP002299.PE252       Location/Qualifiers
FT   CDS_pept        331580..331879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0254"
FT                   /product="tetratricopeptide TPR_2 repeat protein"
FT                   /note="KEGG: ank:AnaeK_0248 tetratricopeptide TPR_2 repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78340"
FT                   /db_xref="UniProtKB/TrEMBL:E3J649"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0248"
FT                   /protein_id="ADP78340.1"
FT                   /translation="MTAPLPVPPELAGEPPQPGPATGLPDGIDALLDEIAAARVTRVRR
FT                   RRQQVADFQTGHLERRRHGLAARHAAKLARLAADTAGTPDAVPSAADLEEDNPQ"
     gtgaccgccc cgctaccggt gccacccgag ctggccggcg agccgccgca gccaggcccg        60
     gcgaccggcc tccctgacgg catcgacgcc ctgctcgacg agatcgccgc ggcccgggtg       120
     accagggtcc gccggcgccg gcaacaggtc gccgacttcc agaccggcca ccttgagcgg       180
     cgccggcacg gcctggccgc ccgccacgcg gccaaactcg cccgcctcgc tgccgacacc       240
     gcgggcaccc ccgacgccgt cccctcggcg gccgaccttg aggaagacaa cccccagtga       300
//

If you have problems or comments...

PBIL Back to PBIL home page