(data stored in ACNUC7421 zone)

EMBL: CP002299.PE254

CP002299.PE254       Location/Qualifiers
FT   CDS_pept        332090..332392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0256"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ptr:745557 hypothetical protein LOC745557"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78342"
FT                   /db_xref="UniProtKB/TrEMBL:E3J651"
FT                   /inference="similar to AA sequence:KEGG:745557"
FT                   /protein_id="ADP78342.1"
FT                   /translation="MADQQPEPGQSPRRRPRFPGDGPPPEGASPAEAREWAEQWLRSYR
FT                   ADRRARRVRAGTVAPTTHAEIRMRLDADEQREHRRTARDKRRQNPPSDGGESAPE"
     atggctgacc agcaacccga gccagggcag agcccgcggc gtaggccccg cttccccggc        60
     gacgggccac cccccgaagg tgcgagcccc gccgaggccc gcgaatgggc cgagcagtgg       120
     ctccgcagct accgcgccga ccggcgcgcc cgccgcgtcc gcgccggcac cgtcgcaccc       180
     accacccacg ccgaaatacg gatgcgcctc gacgccgacg agcagcgcga acaccgccgc       240
     accgccagag acaaacgacg ccagaacccc ccgagcgacg gcggcgaaag cgcacccgaa       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page