(data stored in ACNUC7421 zone)

EMBL: CP002299.PE255

CP002299.PE255       Location/Qualifiers
FT   CDS_pept        332389..332820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0257"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: sro:Sros_1853 hypothetical protein; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78343"
FT                   /db_xref="GOA:E3J652"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E3J652"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADP78343.1"
FT                   /translation="MTACRPVTPRARGRVGGTGAGEAGPDGMPHRGRTDVFEAAFLRDG
FT                   FGAALRSARQRRGWSRRTLAGRSGVSWSAVRALETGVRRPRAVTVRYLAAALALADPAP
FT                   LAAELLGLAGESLRPDTAGAVRQRRRASPRAVALRACGR"
     atgacggcgt gccgaccggt cacccctcgc gcgcgcgggc gcgttggtgg caccggtgcc        60
     ggcgaggccg ggccggacgg gatgccgcac cggggccgga ccgacgtgtt cgaggcggcg       120
     ttcctgcggg acggcttcgg cgccgcgttg cgaagcgcac ggcagcgtcg gggctggtca       180
     aggcggacgc tggcggggcg tagcggcgtc agctggagcg cggtgcgcgc gctggagacc       240
     ggcgtccgcc ggccaagggc cgtgaccgtt cgctacctcg ccgcggccct ggccctggcc       300
     gacccggcgc cgctcgcggc cgagttgctc ggcctcgccg gcgagtcgct gcggccggac       360
     accgccggcg cggtgcggca gcggcgccgg gcctcgccgc gggcagtggc gctgcgcgcc       420
     tgcggccggt ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page