(data stored in ACNUC7421 zone)

EMBL: CP002299.PE256

CP002299.PE256       Location/Qualifiers
FT   CDS_pept        332817..333524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0258"
FT                   /product="regulatory protein MerR"
FT                   /note="PFAM: regulatory protein MerR; KEGG: sro:Sros_1850
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78344"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E3J653"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADP78344.1"
FT                   /translation="MTATRGVNVARLLGPLGFDAAESEHRVARYEWALEAIGRRLGPTM
FT                   RPEALAALERHLRRLPGRGVVLLVEEAAVADLAALCALRELLGQEPPAGWAPAALLLEA
FT                   LIRRAEALARGVFVPAAVAGDVGRLLRVGLDVAARRDGGDPTASSALVALLTDLAAAAR
FT                   EPLPCTDIGTGHQRAEHRGLSVAEAAARMGCTPSYVRRLARRGAIPARRSGGVWIVTET
FT                   PGDDDEHGGDAAS"
     gtgaccgcga cccgtggcgt caacgtggcc cggctactcg gcccgctcgg cttcgacgcc        60
     gccgagtcgg agcaccgggt cgcccgctat gagtgggccc tcgaagcgat cggccgccgc       120
     ctcggcccga cgatgcgacc cgaggccctg gccgcccttg agcggcatct tcgccgcctc       180
     cctggccgcg gggtcgtcct gctcgtcgag gaggccgccg ttgccgacct ggccgcgctg       240
     tgcgccctgc gcgagctgct gggccaagag ccgcccgcgg gctgggcgcc ggccgcgctc       300
     ctgctggagg cgctgatccg gcgtgccgag gcgttggccc ggggcgtgtt cgtcccggcg       360
     gccgtcgccg gcgacgtcgg ccgtctgctg cgcgtcggcc tcgatgtcgc ggcacgccgc       420
     gacggcggcg accccacggc ctcctcagca ctggtcgcgt tgctgaccga cctggccgcc       480
     gccgcccgtg aacccctgcc ctgtaccgac atcggtactg gccatcagcg tgctgagcac       540
     cgtggtctca gcgtcgctga ggctgccgcc cggatgggct gcaccccgtc ctacgtccgc       600
     aggctggccc gccgcggcgc gatccccgcc cgaaggtcgg gcggcgtgtg gatcgtgacg       660
     gagacgcctg gcgatgacga cgaacacggc ggagacgctg ccagctga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page