(data stored in ACNUC7421 zone)

EMBL: CP002299.PE257

CP002299.PE257       Location/Qualifiers
FT   CDS_pept        333490..334176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0259"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cre:CHLREDRAFT_166062 basal body protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78345"
FT                   /db_xref="UniProtKB/TrEMBL:E3J654"
FT                   /inference="similar to AA sequence:KEGG:CHLREDRAFT_166062"
FT                   /protein_id="ADP78345.1"
FT                   /translation="MTTNTAETLPADGMAPDLSDLSSAQLADYLDTSERSAADAGELLA
FT                   GLAELPAAEREEAGVVARARAAIGRRRAEAARREQERRNQASRDRLARVTASIVDRPAD
FT                   SPKVLEAIEQVAAAVATLRAVAAERKQFAKRTSAALLSVGIQPGPRGSAGLWHTRPGFG
FT                   DAVGAGRRMVEPLDPDLLFALAVRRAYGGSLPSGAWQVPQPSSALVAAPDAERLAELLA
FT                   RELGEE"
     atgacgacga acacggcgga gacgctgcca gctgacggca tggcgcccga tctgtccgac        60
     ctgtcctctg cccagctcgc cgactacctg gatacctccg agcggtccgc ggccgacgcg       120
     ggcgagttgc tcgccggcct cgctgaactt cccgccgccg agcgggagga ggccggtgtg       180
     gtcgcccgtg cgagagccgc gatcggccgc cgacgcgcgg aggccgcccg ccgggagcag       240
     gaaaggcgca atcaggcctc ccgcgaccgg ctggcccgcg tcaccgcgtc gatcgtcgat       300
     cggccggccg acagtccgaa ggtgcttgag gcgatcgagc aggtcgccgc ggcggtcgcg       360
     acactgcggg cggtcgccgc ggaacggaag cagttcgcga agcggacctc tgcggcgttg       420
     ctgagcgtcg gaatccagcc gggtccgcgt ggatcagctg ggctgtggca cacccggccc       480
     gggttcggcg acgccgtcgg cgctggcagg cgcatggtcg agccgctcga cccggaccta       540
     ctgttcgcgc tcgcggtccg ccgggcgtac ggcgggtcgc tgcctagcgg cgcctggcag       600
     gtgccgcagc cctcaagcgc cctggtcgcc gcgcccgacg ccgagcggct cgccgagctg       660
     ctcgcccgcg agctggggga agagtga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page