(data stored in ACNUC7421 zone)

EMBL: CP002299.PE258

CP002299.PE258       Location/Qualifiers
FT   CDS_pept        334232..334645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0260"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78346"
FT                   /db_xref="UniProtKB/TrEMBL:E3J655"
FT                   /inference="similar to AA sequence:KEGG:Ndas_0405"
FT                   /protein_id="ADP78346.1"
FT                   /translation="MTGRRATRPVAQRDADWLAAASPDEVSRAHRAGELVELFGGPARF
FT                   EPVEGQQWTAADLDGATADQIGQALARGDLADLLVGREPEPSAPAAPPAAEPALSVIDR
FT                   LYESDPLSANALWSYEERRRGGNGASDDGDAAA"
     gtgaccggcc ggcgcgcgac ccgtcccgtt gcccaacgag acgccgactg gctggccgcc        60
     gcatcgccgg acgaggtgag ccgggcgcat cgcgccggcg agctggtcga gctgttcggc       120
     ggcccggcgc ggttcgagcc ggtcgagggg cagcaatgga ccgcggccga cctcgacggc       180
     gcgacggccg accagatcgg ccaggccctg gcgcgaggcg acctcgccga cctgctggtg       240
     ggccgcgagc cggagccgtc tgcgcccgcg gcccctccgg cggctgagcc ggcgctgtcg       300
     gtgatcgacc ggctttacga gtccgacccg ctctccgcga acgcgctgtg gtcgtacgag       360
     gaacggcgtc ggggtgggaa cggcgcatcc gacgacggcg acgcggcggc gtag             414
//

If you have problems or comments...

PBIL Back to PBIL home page