(data stored in ACNUC7421 zone)

EMBL: CP002299.PE259

CP002299.PE259       Location/Qualifiers
FT   CDS_pept        334649..337330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0261"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78347"
FT                   /db_xref="GOA:E3J656"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E3J656"
FT                   /inference="similar to AA sequence:KEGG:Srot_0075"
FT                   /protein_id="ADP78347.1"
FT                   /translation="MASGGTNVGRLFATLDLDTNAFTSGLARAGTMFASFGRGIATGSS
FT                   YAAAGAAALQGIGGAVAVIGQIAPAAALAVPALIGIGAAMFTVKGAFSGVLSAVKAYGQ
FT                   QTGSAANTSRQAEQAAHGLITAQWGLASATNAYNTAVKEAKQNLADLQKLVDRAPTDME
FT                   QASLDLREAQENLAKVQSNGFSSNDQIEEARLAVTRAQYAFEDQTDAVKKNQDALATAQ
FT                   AQGVDGNQSVIDAVHQLTQAQWALADAQRQAQNPAGPNAYAQAMAKLPPLAQAFARQII
FT                   ALRPQLDQLKVSASSMFVGMGSALRDLDTNFPVVNAGVRQLGESIGTVAARTGALFKGA
FT                   QTQAELGTLMSANATSTLNFGSALGVVGRQFLTIGAVAAPILANISGLAGGVADKFAGW
FT                   VQGAAASGQLQAAIQGALGALGQLAQVVTNVGAGLASLFSGIGSSGAGTLNTLVAISQA
FT                   FREIASNTALQSIIQGLGSAFSGVLGSALTQVMGVITGLLPSIQAIMPALQQVLPIFLL
FT                   FAGGPLGPLLKIVGVMGLLGPLADTIGQVLGQAMTAVAPLLGALGTAFTQLLPPLRLVI
FT                   GSLIQSLMPVISQLVPPLTKVATAIGGALVTVLGTLMTALQPVIPVIGSALVMVVSALA
FT                   DVIVQSLPALNSLIQSIVSLLPPLLPLIPAILGLVVAVLPLIPAVLQIAAAILQALMPV
FT                   IVPLISLLVQLISWFVELNTRAVGLVVGLVTDIAGWLVKLIGHFGDLPGLIGKALSGLE
FT                   KLITAPFKAAFNAVSDLWNRSLGSIHFTVPNWVPGVGGKGFSFPTLPKLAKGGTFASSG
FT                   LAIVGDDGPEILSGKPGATITPLSRASGGGGGIVINMSITHNGMISDKQVLDDFAAKIV
FT                   GPLKTQINRYAASNGGSAGLAA"
     gtggcctccg gtgggaccaa cgtcggccgc ctcttcgcga ccctcgattt ggacacgaac        60
     gcgttcacgt cggggctggc ccgcgccggg acgatgttcg catcgttcgg ccgggggatc       120
     gcgaccggca gctcctacgc ggcggccggt gcggcggcgc tgcaggggat cggtggcgcg       180
     gtcgccgtca tcgggcagat cgcccccgcg gccgcgctcg ccgtcccggc gctgatcggc       240
     atcggcgcgg cgatgttcac ggtcaagggc gccttctccg gcgtgctgtc cgcggtcaag       300
     gcctacggcc agcagaccgg ttcggccgcg aacacctcga ggcaggcgga gcaggccgcc       360
     catggcctga tcaccgccca gtgggggctg gcgtcggcga cgaacgccta caacaccgcc       420
     gtcaaggaag cgaagcagaa cctcgctgac ctgcagaagc tggtcgaccg ggcgccgacc       480
     gacatggagc aggcgtccct ggacctgcgg gaggcgcagg agaacctcgc gaaggtccag       540
     tcgaacgggt tctccagcaa cgaccagatc gaagaggccc gcctcgcggt cacccgcgcg       600
     cagtacgcct tcgaggacca gaccgacgcg gtcaagaaga accaggacgc cctcgcgacc       660
     gcccaggcgc aaggcgtcga cggcaaccag tcggtgatcg acgccgtcca ccaactgacc       720
     caggcgcagt gggccctcgc cgacgcccag cggcaggccc agaacccggc cgggccgaac       780
     gcctacgcgc aggcgatggc gaaactcccg ccgctcgcgc aggccttcgc ccgccagatc       840
     atcgccttgc gcccgcagct ggaccagctg aaggtctccg cttcgtcgat gttcgtcggg       900
     atgggctccg cccttcgcga tcttgacacg aacttccccg tcgtcaacgc cggggtgcgg       960
     cagctcggcg agtcgatcgg cacggttgcc gcacggaccg gggcgctgtt caaaggcgcc      1020
     cagacgcagg ccgagctcgg cacgctgatg tcggcgaacg ccacctcgac gctgaacttc      1080
     ggctccgccc taggcgtcgt cggccgccag ttcctgacga tcggcgcggt cgccgcgccg      1140
     atcctcgcga acatctcggg cctcgccggc ggcgtcgccg acaagttcgc cggctgggtc      1200
     cagggcgccg cggcgtccgg gcagctgcag gccgcgatcc agggtgcatt gggcgcgctg      1260
     ggccagctcg cccaggtcgt gaccaacgtc ggcgctggcc tggcgtcgtt gttctccggg      1320
     atcggttcgt cgggcgccgg gacgctgaat accctcgtcg cgatctccca ggccttccgt      1380
     gaaatcgcca gcaacaccgc cctccagtcg atcatccaag ggctggggtc ggcgttctcg      1440
     ggcgtgctgg ggtcggcgct gacgcaggtg atgggggtca tcaccggcct cctcccgtcg      1500
     atccaggcga tcatgccggc gctgcagcag gtactcccga tcttcctgct gttcgcgggt      1560
     ggcccactcg gcccactcct caagatcgtc ggcgtgatgg ggctgctggg cccgctcgcc      1620
     gacacgatcg gccaggtcct cggccaggcc atgaccgcgg tcgcgccgct gctgggcgcc      1680
     ctcggcaccg cgttcacgca gctgttgccg ccgctgcgcc tggtcatcgg gtcgttgatc      1740
     cagtcgctga tgccggttat ctcgcagctg gtaccgccgc tgaccaaggt cgccacggcc      1800
     atcggcggcg cgctcgtcac ggtgcttggc acgctgatga ccgcgctaca gccggtgatt      1860
     ccggtcatcg ggagcgcgct ggtcatggtc gtctcggcgc tggccgatgt gatcgtccag      1920
     tcgctgcccg cgctgaactc gttgatccaa tcgatcgtgt ccctcctgcc gccgctacta      1980
     ccgctgatcc cggcgatcct ggggcttgtc gtcgcggtcc tgccgctgat cccggcggtc      2040
     ctccaaatcg cggcggcgat cctgcaggcc ctgatgcccg tgatcgttcc gctgatctcg      2100
     ctgctcgtgc agctgatctc atggttcgtc gagctgaaca caagggccgt cgggcttgtc      2160
     gtcggcctgg tgacagacat cgccggctgg ctggtcaagc tcatcggcca cttcggcgat      2220
     ctgcctggtc tgatcggcaa ggcgctgtcc ggcctggaga agctgatcac cgcgcctttc      2280
     aaggccgcgt tcaacgccgt gtcggacctg tggaacaggt cgctcggcag catccacttc      2340
     accgtgccga actgggtacc cggcgtcggc ggcaagggct tctcgttccc gacgctgccg      2400
     aaactcgcga agggcggcac gttcgcctca agcggtctcg cgatcgtcgg cgacgacggc      2460
     cccgagatcc tctccgggaa gcccggcgcg acgatcaccc cgctgagccg ggccagcggg      2520
     ggaggcggtg ggatcgtcat caacatgtcg atcactcaca acggaatgat ctccgacaag      2580
     caggtgctcg acgacttcgc cgcgaagatc gtcggtccgc tgaaaaccca gatcaatcgg      2640
     tatgccgcca gtaacggcgg ctcggctggt ctcgcggcct ga                         2682
//

If you have problems or comments...

PBIL Back to PBIL home page