(data stored in ACNUC7421 zone)

EMBL: CP002299.PE260

CP002299.PE260       Location/Qualifiers
FT   CDS_pept        337429..337947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bfa:Bfae_28240 galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78348"
FT                   /db_xref="UniProtKB/TrEMBL:E3J657"
FT                   /inference="similar to AA sequence:KEGG:Bfae_28240"
FT                   /protein_id="ADP78348.1"
FT                   /translation="MATEGFPGGVDSVKSWLADLFGEEPGRSLWTVLDGPLRLALAQGW
FT                   ILGTSGSRADDLAEELAAADSSHRRFPAMLAALADHWRRVYADLRDGAGVVNLNLLAGA
FT                   DMEAVVLTGQEYGDQVVRQVVGHVFITRLDGDGWHIAALSRKLPIPGWPPTEQEISGLE
FT                   VTSRPLGHA"
     atggccaccg agggatttcc aggcggcgtg gacagcgtca aaagttggct cgctgacctg        60
     ttcggcgaag agccggggcg cagtctgtgg accgtgctcg acgggccgct ccgcctcgca       120
     ctcgcccagg gatggatcct cggcaccagc ggttcgcgcg cggacgacct cgccgaggag       180
     ctcgccgcgg ccgactccag ccacaggcga ttccctgcga tgctcgctgc cttggccgat       240
     cactggcggc gcgtgtacgc cgatctacgc gacggagccg gagtggtgaa cctcaacctc       300
     ctcgccggcg ccgacatgga agccgtcgta ctcaccggtc aggagtacgg cgaccaggtc       360
     gtccgccagg tcgtcgggca cgtgttcatc actcggctgg acggcgacgg ctggcacatc       420
     gccgctctga gccgcaaact gcccattccc gggtggcccc cgaccgagca ggagatctca       480
     ggacttgaag tgaccagccg cccgcttggc cacgcctag                              519
//

If you have problems or comments...

PBIL Back to PBIL home page