(data stored in ACNUC7421 zone)

EMBL: CP002299.PE264

CP002299.PE264       Location/Qualifiers
FT   CDS_pept        complement(339615..340769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0266"
FT                   /product="protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase"
FT                   /note="PFAM: protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase; KEGG: fal:FRAAL2939 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78352"
FT                   /db_xref="GOA:E3J661"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3J661"
FT                   /inference="protein motif:PFAM:PF01135"
FT                   /protein_id="ADP78352.1"
FT                   /translation="MIAVAASDDEWPALARDLADKVTHPGSRWHPVIASIPRHAFVPAW
FT                   WARSDGGWQLRRGPLAEVYVNQTLVTRVGPHHANHGYPPGGPPVGRSTSSSTLPGLLLT
FT                   MYRDAQLAEGLDIADVGTGSGYGAALLATRYGASHVTTMDVDPYLVEAAAVALDAGGLA
FT                   PAAQVVDATGPLPGTYDRIVSTVSVRSIPPSWLAALRPGGRLVTSITGTWLVLTAWRTA
FT                   DGEIWGKVARHWAGFMPTRSGGDYPPEWADFADLATRDGDEVGAGRYPVLDIDDAWELS
FT                   TMLALAAGVDVEHQYLPPGPDGAHTALMAHPDGSWARATAIGTEAPLVHQGGPRRLWDL
FT                   LDGVRDDWLRMGMAPWLGAHALVRPDGAVVLAMGSWRATIPATP"
     atgatcgccg tcgccgcgtc ggacgacgag tggccggcgc tcgcccgcga cctcgccgac        60
     aaggtgaccc atcccgggtc tcggtggcac cctgtcatcg cgtccatacc caggcacgcg       120
     ttcgtgcccg cctggtgggc ccggagcgac ggcgggtggc agctgcgccg cggcccgctc       180
     gccgaggtgt acgtcaacca gacgctggtg acccgcgtcg gcccgcacca cgccaatcac       240
     ggctacccgc ccggcgggcc acccgttgga cgctcgacct cgtcctcgac gctgccgggg       300
     ctgctgctga cgatgtaccg agatgcgcag ctcgccgagg ggctcgacat cgccgacgtc       360
     ggcaccggat cgggatacgg cgcggcgctg ctcgctaccc ggtacggcgc cagccacgtc       420
     accacgatgg acgtcgaccc ctacctcgtc gaagccgcgg cggtcgcgct cgacgcgggc       480
     ggcctggccc cggccgcaca ggtcgtggac gcaaccggac cgctgcccgg gacctacgac       540
     aggatcgtct ccaccgtctc ggtgcggtcg atcccgccgt cctggctggc cgcgctgcgg       600
     cccggcggcc ggctcgtcac gtcgatcaca ggcacctggt tggtcctcac cgcgtggcgg       660
     accgccgacg gcgagatctg gggcaaagtg gcgcggcatt gggccgggtt catgcccacg       720
     aggagcggcg gcgactaccc gcctgagtgg gccgacttcg ccgacctcgc gacccgtgac       780
     ggcgacgagg tcggcgccgg ccgctacccg gtgcttgaca tcgacgacgc gtgggaactg       840
     tcgacgatgc tggcgctcgc cgcgggagtc gacgtcgagc accagtacct gccgccgggc       900
     ccggacggcg cccacacggc gctgatggcc cacccggacg gctcctgggc ccgggccacc       960
     gcgatcggta ctgaggcgcc gctggtccac cagggcggac cgcggcggct ctgggacctc      1020
     ctcgacgggg tccgcgacga ctggctacgc atgggaatgg ccccatggct cggcgcccac      1080
     gccctggtca ggccggacgg cgccgtggtc ctcgcgatgg gcagctggcg ggcaacgatc      1140
     cccgccaccc cgtga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page