(data stored in ACNUC7421 zone)

EMBL: CP002299.PE269

CP002299.PE269       Location/Qualifiers
FT   CDS_pept        complement(345998..346180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0271"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpo:Mpop_5368 TspO and MBR like protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78357"
FT                   /db_xref="UniProtKB/TrEMBL:E3J666"
FT                   /inference="similar to AA sequence:KEGG:Mpop_5368"
FT                   /protein_id="ADP78357.1"
FT                   /translation="MIRVLMVLAVLAVLVPVPGVALALVVLAAAGAVARFAVWSYRADP
FT                   PVWRSPGPNWSGRFV"
     atgatccgcg tcctgatggt gctggccgtc ctcgccgtcc tcgtgcccgt gcctggtgtc        60
     gccctggccc tggtcgtcct cgcggcggcc ggggcggtcg cgcggttcgc ggtctggtcc       120
     taccgggccg acccgccggt gtggcggtcg cccggcccga actggtctgg gaggttcgtg       180
     tga                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page