(data stored in ACNUC7421 zone)

EMBL: CP002299.PE27

CP002299.PE27        Location/Qualifiers
FT   CDS_pept        30567..31760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0027"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: sti:Sthe_2831
FT                   integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78115"
FT                   /db_xref="GOA:E3J277"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E3J277"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADP78115.1"
FT                   /translation="MAEQKNEPDGAASAEEKKSRRAHGEGGLYQRASDNRWVGVVDLGW
FT                   IDGKRRRRTVYGRTQKEARGKMNALREAAGKGQDLAAKPQTVAEWLSYWLDEIKGHDGT
FT                   RPSTLSRYRYAIDGHIVPVLGKIRLDKLSPADVRRLHAARRDSMKPASLAKIHAVLRVA
FT                   LADAERMDLVSRNVAKSVQPPKLGDSDPRDLAVEDARRFLEVAAGDRLEALFVVALTMG
FT                   LRRGELLGLRWDDVDLDAATLRVVRSAQRVSGTLRLVDTKTRGSRRPVPIPAMTLEALK
FT                   RHRKRQDQERADAGKAWKENGLVFASTVGTLIEPRNVTRRVQQLRGRVNLPTLRLHDFR
FT                   HACASFLLAAGIEPRTVMEILGHATMRMTMERYGHALPERLRAASDAMDKLMGQRLP"
     atggccgagc agaagaacga accggacggc gcggcgtcgg cggaagagaa gaagtctcga        60
     cgcgcgcacg gcgagggcgg cctgtaccag cgggcgagtg acaaccgctg ggtcggggtc       120
     gtcgacctcg gctggatcga cggcaaacga cgccgtcgga ctgtgtacgg ccggacgcag       180
     aaggaagcgc gcggcaagat gaacgcgctg cgcgaggcgg ccggcaaggg tcaagatctc       240
     gccgcgaagc cccagacggt cgcggagtgg ctgtcgtact ggctcgacga gatcaaaggg       300
     catgacggaa cgcggccgtc gacgctgagc cgctaccgat acgcgatcga cggacacatc       360
     gtgcctgttc tcggcaagat ccggctggac aagctgagcc cggccgacgt ccgtaggctg       420
     catgcggcgc gccgcgactc gatgaagcca gcgagcttgg ccaagattca cgccgtcctg       480
     cgcgtagccc tcgcagatgc ggagcgcatg gacctggtgt cccgcaacgt cgcgaagtcg       540
     gttcaaccgc ccaagctcgg cgactcggac ccgcgggacc tggcggtcga agacgcgcgc       600
     cgattcctcg aagtcgcggc aggcgatcgc ctcgaagcgc tcttcgtggt cgcactcacg       660
     atgggcctac gccgcggcga gctgctcggc ctgcgctggg atgacgtcga cctcgacgcg       720
     gcaaccctcc gcgtcgtccg ctcggcccag cgcgtgtccg gcacgcttcg gctggtcgac       780
     acgaagacga gaggctcacg gcgcccggtg ccgatcccgg caatgacgtt ggaagcgctc       840
     aagcggcaca ggaagcggca ggaccaggag cgcgccgacg cgggcaaagc ctggaaagag       900
     aacggcctcg tcttcgcgtc cacggtcggc acgctgatag agccgcgcaa cgtcacgcgc       960
     cgagttcagc agctccgcgg acgggtgaac ctgccgacgc tccggctcca cgacttccgc      1020
     cacgcctgcg cgagcttcct cctggcggcc ggcatcgaac ctcggaccgt aatggagatc      1080
     ctcggtcacg ccacgatgcg catgaccatg gagcgctacg gccacgccct ccccgaacgc      1140
     ctgcgcgccg cgtccgacgc catggacaag ctgatgggcc agcgtctgcc gtga            1194
//

If you have problems or comments...

PBIL Back to PBIL home page