(data stored in ACNUC7421 zone)

EMBL: CP002299.PE271

CP002299.PE271       Location/Qualifiers
FT   CDS_pept        complement(346488..347309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cai:Caci_2884 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78359"
FT                   /db_xref="UniProtKB/TrEMBL:E3J668"
FT                   /inference="similar to AA sequence:KEGG:Caci_2884"
FT                   /protein_id="ADP78359.1"
FT                   /translation="MTGRAYPLPRPDDDPRFTFGLMLDVAAVLARRGYPTLTSGADLVE
FT                   LQQALFGFLYAAAPDDGQQHVEGPAVPAAPVVVERCECGALVADHRGAGWREAGACGSL
FT                   VAFAPATLAGVDSVVCLGTDSEPCGHLGADHSDWGKPGGCRGCGCTRSYDHGKPGDDDA
FT                   AGTVAAAVIGGARWTWRYEGAGIWQRVGSDGALTSRQLRALGAVVTDLPGASADDDDLA
FT                   HRRAGAEAMLRAAERRAGTEADSDGRWTAQAGQLADEIASIDQALQPDGDQ"
     atgaccggcc gcgcctaccc gctgccccgg ccggacgacg acccgcggtt cacgttcggc        60
     ctgatgctgg acgtcgccgc ggtgctcgcg cggcgcggct atccgacgct cacgtccggc       120
     gccgacctcg tcgagctcca gcaggcactg ttcggcttcc tgtacgcggc ggcgccggat       180
     gacggccagc agcacgttga ggggccggcc gtaccggcgg ccccagtcgt ggtcgagcgc       240
     tgcgagtgcg gcgccctggt cgcggaccac cgcggcgccg gttggcgtga ggcgggggcg       300
     tgcgggtcgc tggtcgcctt cgcgccggcc accctggccg gtgtcgactc ggtggtctgc       360
     ctcggcaccg acagcgagcc gtgcggccat cttggcgccg accacagcga ctggggcaag       420
     ccgggcggct gccgcgggtg cggctgcacc cgttcctacg accacgggaa gccgggtgac       480
     gacgacgcgg cgggcacggt cgccgcggcc gtcatcgggg gcgcccgctg gacgtggcgg       540
     tacgaaggcg ccggtatctg gcagcgggtc ggcagcgacg gcgcgctcac cagccgccag       600
     ctgcgggcgc tcggcgccgt cgtgaccgac ctgcccggcg cgtcggccga cgatgacgac       660
     cttgcgcatc ggcgtgccgg tgccgaggcg atgctgcgcg ccgccgaacg acgcgctggc       720
     accgaggccg acagcgacgg ccggtggacg gcgcaggccg gccagctggc cgacgagatc       780
     gccagcatcg accaggcgct acagccggat ggtgaccagt ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page