(data stored in ACNUC7421 zone)

EMBL: CP002299.PE275

CP002299.PE275       Location/Qualifiers
FT   CDS_pept        complement(348698..349375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0277"
FT                   /product="Clp domain protein"
FT                   /note="PFAM: Clp domain protein; KEGG: mbo:Mb2686
FT                   ATP-dependent protease ATP-binding subunit ClpX'"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78363"
FT                   /db_xref="GOA:E3J672"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:E3J672"
FT                   /inference="protein motif:PFAM:PF02861"
FT                   /protein_id="ADP78363.1"
FT                   /translation="MEIAEQIIAAVKPLKGDELHQLSAAAWQVARIQIEADVAMRMFVE
FT                   QALEAGASWVEVGGLLGIGHRAARERFGPESTASVAEPFSHYTKDASDSVTAASREART
FT                   LGSPYLGTEHLLLGLLGQPGSRATRVLEWLDVSHASIRDAVNEETVHREAPSAAHLAFT
FT                   GRAQAVLQTHAPREMSRAQAELIDTDILLLALLADEGGIARRVLESSGVTADRVRSWRA
FT                   QAT"
     atggagatcg ccgagcagat catcgccgcc gtcaaaccgc tcaagggcga cgagctacac        60
     caactttcgg cggcggcctg gcaggttgcc agaattcaga tcgaggccga cgtcgccatg       120
     agaatgttcg tcgaacaggc gttggaggct ggcgcttcct gggtcgaggt cgggggcctg       180
     ctcggcatcg gccaccgagc ggccagggag cgcttcgggc ccgaaagcac cgcctcggtc       240
     gcagagccct tctcgcatta cacgaaggac gcctcggact cggtcaccgc ggcgtcgagg       300
     gaggcccgga cactcggcag cccctacctc ggcactgagc atcttctgtt aggactactc       360
     ggtcagcccg gttccagggc cacgcgggtt cttgagtggc tcgacgtctc gcacgcgtcg       420
     atacgcgacg cggtgaacga ggagacagtg caccgcgagg ccccgtcggc agcgcatctc       480
     gccttcacag gccgggccca ggcagtactc cagacgcacg cgccgcgcga gatgagccgc       540
     gcccaagcag aactcatcga caccgacatc ctcctgctgg cgctcctcgc ggacgagggc       600
     ggcatagccc gcagagtcct cgagtcatcg ggcgtcacgg cggatcgagt gcgttcctgg       660
     cgagcccagg ccacctga                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page