(data stored in ACNUC7421 zone)

EMBL: CP002299.PE276

CP002299.PE276       Location/Qualifiers
FT   CDS_pept        complement(349662..350840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0278"
FT                   /product="translation elongation factor Tu"
FT                   /note="KEGG: sma:SAV_7028 elongation factor Tu; TIGRFAM:
FT                   translation elongation factor Tu; small GTP-binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain-containing protein; elongation
FT                   factor Tu domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78364"
FT                   /db_xref="GOA:E3J791"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:E3J791"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ADP78364.1"
FT                   /translation="MAKQAYVRTKPHLNIGTMGHVDHGKTTLTAAITKVLADGGSGTFI
FT                   PFDRIDRAPEEIARGITINIAHVEYETANRHYAHVDMPGHADYVKNMITGAAQLDGAIL
FT                   VVSAQDGIMPQTTEHVLLARHVGVRHVVVALNKADAADPELTDLVELEIRELLSAHGYP
FT                   GEEIPVVRVSGLRALAGDPTWTASIATLLDAVDSYVPVPDRYTGAPFLLPVENVLTITG
FT                   RGTVVTGAIERGTVRVGDRVEVRGLGTALTTVVTGLETFGKPMDSGQAGDNVALLLRGV
FT                   QRGQIRRGNVVAAPGSVTVHQRFAAQVHLLTAAEGGRRTAIASGYRPQFYLRTTDVAGE
FT                   VDLGEAGLALPGETAELTVELSKPVPLETGLGFAIREGGRTVGAGTVVTVLD"
     atggccaagc aggcctacgt ccgcacgaag ccgcatctca acatcggcac gatgggtcac        60
     gtcgaccacg ggaagaccac gctcaccgcc gcgatcacga aggtgctcgc cgacggtggc       120
     tccggcacgt tcatcccgtt cgaccggatc gaccgcgccc ccgaggagat cgctcgcggc       180
     atcacgatca acatcgcgca cgtcgagtac gagaccgcca accggcacta cgcgcacgtc       240
     gacatgccgg gccacgccga ctacgtgaag aacatgatca ccggagctgc gcagctcgac       300
     ggcgcgatcc tggtggtgtc ggcgcaggac ggcatcatgc cgcagacgac cgagcacgta       360
     ctgctggctc ggcacgtcgg agtcaggcac gtggtggtcg cgctgaacaa ggcggatgcc       420
     gccgacccag agctcaccga cctggtggag ctcgaaatcc gcgagttgct gtcggcgcac       480
     ggctacccag gtgaggagat tccagtggtc cgcgtgtcgg ggctgcgcgc gctggcgggt       540
     gaccccacgt ggacggcctc gattgccacg cttctcgacg cggtcgacag ctacgtcccc       600
     gtccccgacc gctacaccgg cgcgccgttc ctgcttccgg tggagaacgt cctgacgatc       660
     accggccgcg ggacggtggt aaccggggcg atcgagcggg gaacggtccg cgtcggcgac       720
     cgggtcgagg tccgcggcct cggaacggcg ctgacgacgg tggtcaccgg cctggagacg       780
     ttcggcaagc caatggactc cggtcaggcc ggtgacaacg tcgccctact gctgcgcggg       840
     gtgcagcgcg gacagatccg gcggggaaac gtcgtcgccg cgccgggaag cgtgacggtc       900
     caccaacggt tcgccgcgca ggttcacctg ctcacggcgg ccgagggcgg ccggcgcacc       960
     gcgatcgcgt ccggctaccg cccgcagttc tacctgcgga ccacggacgt cgccggcgag      1020
     gtcgacctgg gcgaggccgg cctggcgctg ccgggcgaga ccgccgagct gacggtcgag      1080
     ctcagcaagc ccgtgccgct ggagaccggg ctcggcttcg ccatccgcga gggcggccga      1140
     acggtcggcg ccggaaccgt cgtcaccgtg ctcgactga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page