(data stored in ACNUC7421 zone)

EMBL: CP002299.PE279

CP002299.PE279       Location/Qualifiers
FT   CDS_pept        complement(352444..353565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0281"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: fal:FRAAL6619 putative ABC transporter
FT                   ATP-binding subunit; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78367"
FT                   /db_xref="GOA:E3J794"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J794"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP78367.1"
FT                   /translation="MIDARGLTKRYGRTLAVNDLSFTVRSGRVTGFLGPNGAGKSTTMR
FT                   MILGLDRPTAGEVRIGRKRYADLTNPMRHVGALLDAKWVHPNRSARAHLRWLAAANRLP
FT                   DRRVDEVLEIVGLTDVAHRRAGGFSLGMAQRLGIAGALLGDPGVMLFDEPVNGLDPEGI
FT                   LWIRRLMHRLADEGRTVFVSSHLLSEMAVTASELVVIGRGRLIAQTTTAAFTDQASGAT
FT                   VRVRGPEPHRLRAVLTAGGLAVDEVPASDAGPAAFTVHDATTEAVGELAGAAGLVLHEL
FT                   AAQRGSLEEAFLQLTSRDVEYRAGDGYSEPAGFPEPAGYPEPAGYPEPAGYPEPAGYPE
FT                   PAGYPEPAGYPEPAGYAEPAGGLVWEAETSWPA"
     atgatcgacg cccgcgggct gaccaagcgt tacggccgca cgctcgcggt caacgacctg        60
     tcgttcaccg tgcggtccgg ccgggtgacc ggcttcctcg gtccgaacgg ggcgggcaag       120
     tccaccacca tgaggatgat cctcgggctg gaccgcccga ccgcgggcga ggtccgcatc       180
     ggccgcaagc gctacgccga cctgaccaac ccgatgcgcc acgtcggcgc cctgctcgac       240
     gcgaaatggg tccacccgaa ccggtccgcc cgcgcccacc tgcgctggct ggccgccgcc       300
     aacaggctgc cggaccgacg ggtcgacgag gtcctcgaga tcgtcgggct gaccgacgtg       360
     gcccaccggc gggccggcgg cttctcgctc ggcatggcgc agcgactcgg catcgcgggc       420
     gccctgctgg gcgaccccgg ggtgatgctg ttcgacgagc cggtcaacgg cctcgatccc       480
     gaagggattc tctggattcg gcggctcatg caccggctgg cggacgaggg ccgcacggtg       540
     ttcgtctcca gtcatctgct gtccgagatg gcggtgaccg cgagtgagtt ggtcgtcatc       600
     ggccggggcc ggctgatcgc gcagaccacc acggccgcgt tcaccgacca ggcatccggc       660
     gcgacggtac gggtccgggg gcccgagccg caccggctgc gggccgtcct gaccgccggc       720
     gggctggccg tcgacgaggt gcccgcctcc gacgcgggtc ccgcggcctt caccgtgcac       780
     gatgcgacca cggaggcggt cggcgagctc gccggtgccg ccggcctcgt cctgcacgaa       840
     cttgccgccc agcgcggctc gttggaggag gcgttcctgc agctgaccag ccgggacgtc       900
     gaataccggg ccggtgacgg ctactcggag ccggccggtt ttccggagcc agccggttac       960
     ccggagccag ccggctaccc ggagccagcc ggctacccgg agccagccgg ctacccggag      1020
     ccagccggtt acccggagcc agccggttac ccggagccag ccggctacgc ggagccggcc      1080
     ggcggcttgg tgtgggaggc ggagacctcg tggccggcct ga                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page