(data stored in ACNUC7421 zone)

EMBL: CP002299.PE282

CP002299.PE282       Location/Qualifiers
FT   CDS_pept        356772..357503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78370"
FT                   /db_xref="UniProtKB/TrEMBL:E3J797"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6608"
FT                   /protein_id="ADP78370.1"
FT                   /translation="MTLCGLLRLDGADVRRSTLTAMLASSSLGLPAARGVHLDGPFGVV
FT                   TAAGRAGGPIPPIVVDDGGLMAVVLAGRGHLRLAGWPACPAGQAGDAGEPSGSARDEDT
FT                   AALSVAAAYRASGERCLRELPPDRLVLVWDPGARRLLVTRTGRFAADLLTWSDGRHLAF
FT                   GTEPAQLLAAFRAPAQVVGPRLDGSGRPRRLVRRLAVGEGISISVTAARRGPRPSRPAA
FT                   LRLVPRPAAPDSADRHRIDRD"
     gtgaccctgt gcggcctgct gcggctggac ggagcggacg tccgccggtc caccctgacg        60
     gcgatgctcg cctcgtcctc cctgggcctg ccggcggccc gcggcgtcca tctcgacggg       120
     cccttcggcg tcgtcaccgc cgctggaagg gcgggcggcc cgatcccacc gatcgtggtg       180
     gacgacggcg ggctgatggc cgtcgtgctc gcgggccgcg gccacctgcg gctcgccggt       240
     tggccagcct gtccggcggg ccaggctggc gacgcggggg agccgagcgg gtcggcgcgc       300
     gacgaggaca ccgcggccct gagtgtcgcc gcggcctacc gggccagcgg cgagcgctgc       360
     ctgcgcgagc taccgccgga ccggctcgtg ctcgtctggg acccgggcgc cagacggctg       420
     ttggtcaccc gcaccgggcg gttcgccgcc gacctgctga cctggtcgga tgggcggcac       480
     ctcgcgttcg gtaccgagcc ggcgcagctg ttggccgcgt tccgggcccc tgctcaggtc       540
     gtcggcccac ggctggacgg atccggccgg ccccgccggt tggtacgtcg gctggcggtc       600
     ggcgagggga tctcgatctc ggtgacggcg gcccgccgcg gtccgcgccc gtcgcggccg       660
     gccgcgctgc ggctcgtgcc gcgcccggcc gcccccgaca gcgccgaccg tcaccggatc       720
     gaccgagact ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page