(data stored in ACNUC7421 zone)

EMBL: CP002299.PE285

CP002299.PE285       Location/Qualifiers
FT   CDS_pept        complement(359210..360547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0287"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6605 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78373"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7A0"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6605"
FT                   /protein_id="ADP78373.1"
FT                   /translation="MSLCGKRVPSSTAVDGPEDLAVAGPAVAHQDADLTVARLTSADLA
FT                   HTGSAFGALDDFGTGEPGGTAPVAGRPFGADEPSGPEPLAERFEQVLGEYSVDSASLRA
FT                   RVLTATTAAQRDLAAGKRAADTARRRSRTRPRSTRPAAGPVSARSAGAHRAGAARPRLV
FT                   TAGALAAVVSVIGVSAGIASVVQSQSKPSRVLVTPAPRALVTQPAAPLPAPATQAPDAP
FT                   SATPSAGQSQSTADPTAANGSQSVASTSQQRGAASGRGGQVPSGQDNRPRAVRGWSVAP
FT                   FRSGSELVLPDRNTTDWVVFGDGHGGVVARAAIPFQLLDVSRIAGVGSAQRGYPTSVSW
FT                   TWGTPRPQGSHSTTRLRIPGGRSATIATYRGPHDGKLAFYVGGAASLRVTVSAAGLQSS
FT                   TFTVALPSSTAVVTLDLGGLPYWTPATISISGAGGSSFSLAAAVLD"
     gtgagtctct gtggcaagcg cgtccccagt tccaccgcgg tcgacgggcc ggaggacctc        60
     gctgtcgcgg gtcccgcggt cgcgcaccag gacgccgacc tcacggtcgc ccggctgacg       120
     tccgcggatc tcgcccacac cggctccgcg ttcggcgcgc tcgacgattt cgggaccggc       180
     gaaccgggcg gcaccgcgcc ggtcgccggc cgcccattcg gggctgacga gccatccggt       240
     ccggaaccgc tggccgagcg gttcgagcag gtgctcgggg agtactccgt cgacagcgcc       300
     agcctgcggg cgcgggtgct gaccgccacg accgcggccc agcgcgacct cgccgccggc       360
     aagcgcgcgg cggacaccgc ccgccgccgc tcgcgtaccc ggccgcgctc gacccgcccc       420
     gccgccggcc cggtcagcgc ccggtcggcg ggagcgcacc gggcgggcgc cgcgcgaccg       480
     cgtctggtca ccgccggcgc cctcgccgcc gtggtcagcg tgatcggcgt cagcgcgggt       540
     atcgcgagcg tcgtccagag tcagtcgaag ccgtcacgcg tcctggtgac gcccgcgccc       600
     cgcgccctcg tcacgcagcc ggccgcaccg ctgccagccc ccgcgaccca ggcgcccgac       660
     gcgccgagcg ccacgccgtc ggccggccag agccagtcga cggccgaccc cacagccgcc       720
     aacggatcgc agagcgtcgc cagtaccagc cagcaacggg gagcggcgtc cggccgcggc       780
     ggccaggtcc cctcgggtca ggacaaccgc ccgcgggctg tccggggctg gagcgtcgcc       840
     ccgttccggt ccggcagcga actcgtcctg cccgacagga acacgaccga ctgggtcgtg       900
     ttcggcgacg gccacggcgg ggtcgtggca cgggccgcca tcccgtttca gctcctggac       960
     gtcagcagga tcgccggggt cgggtcggcg cagcgcggct accccacgag cgtgagctgg      1020
     acctggggga cgccgcgccc gcagggcagc cattccacga cccggctgcg gattcccggg      1080
     ggccgttcgg ccacgatcgc gacgtaccgc ggcccgcatg acgggaagct cgccttctac      1140
     gtgggcggag ccgcgagcct gcgggtgacc gtgtccgcgg ccggcctgca gtcgagcacc      1200
     ttcacggtcg cgctgccgag ctcgaccgcg gtggtcacgc tggacctcgg cgggctgccc      1260
     tactggacgc cagccacgat cagcatctcc ggcgcgggcg gaagctcatt ctccctcgcg      1320
     gccgccgtcc tcgactag                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page