(data stored in ACNUC7421 zone)

EMBL: CP002299.PE288

CP002299.PE288       Location/Qualifiers
FT   CDS_pept        362033..363019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0290"
FT                   /product="NAD(P)H quinone oxidoreductase, PIG3 family"
FT                   /note="KEGG: fal:FRAAL6600 putative quinone oxidoreductase;
FT                   TIGRFAM: NAD(P)H quinone oxidoreductase, PIG3 family; PFAM:
FT                   Alcohol dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78376"
FT                   /db_xref="GOA:E3J7A3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7A3"
FT                   /inference="protein motif:TFAM:TIGR02824"
FT                   /protein_id="ADP78376.1"
FT                   /translation="MYAVTVDEPGGPEVLEWREVDDPPGPGPDEVVIDVVATAVNRADL
FT                   LQRQGLYAPPPGASDIIGLECSGRIAAVGPGVDGWRVGDEVCALLSGGGYATKVVVPAG
FT                   QVLPVPPGVDLVTAGGLPEVTSTVYSTVFQRAQLLDGETFLVHGGASGIGTFAIQAVRA
FT                   LRPKALIATTAGSPEKLERCRELGADVTICYRDEDFVARVKEATGGRGADVILDNMGAK
FT                   YLARNVDVLAPDGRLVVIGMQGGIKAELNLATLLTKRGAVHAMSLRHRPGEQKAAIVAG
FT                   VRAEVWPAFASGAIRPVIDRVLPLREAAEAHRVVESLGHVGKVLLAV"
     gtgtacgcgg tcacggtgga cgagcccggt ggtcccgagg tgctcgagtg gcgcgaggtg        60
     gacgacccgc ccggccctgg cccggacgag gtggtcatcg acgtcgtcgc caccgcggtc       120
     aatcgggccg acctgcttca gcgccaaggg ctctacgcgc cgccgcctgg tgcctcggac       180
     atcatcggcc tggagtgctc cgggcggatc gcggccgtcg ggccgggcgt cgacggctgg       240
     cgggtcgggg acgaggtctg cgcgctgctc tccggcggcg gctacgcgac gaaggtcgtc       300
     gtccccgccg gacaggtgct cccggtgccg ccgggggtcg acctggtcac cgccggcgga       360
     ctgcccgagg tcacctcgac cgtctactcg accgttttcc aacgggccca actcctcgac       420
     ggcgagacgt tcctggtgca cggcggcgcc tccgggatcg gcaccttcgc gatccaggcc       480
     gtccgggccc tgcggccgaa ggccctgatc gcgacgacgg cgggctcccc ggagaagctg       540
     gagcgctgtc gcgagctcgg cgcggacgtc accatctgct accgggacga ggacttcgtg       600
     gcccgggtga aggaggcgac cggtgggcgc ggcgcggacg tcatcctcga caacatgggc       660
     gcgaagtacc tggcccgcaa cgtcgacgtg ctcgcccccg acggccggct ggtggtgatc       720
     ggcatgcagg gtggcatcaa ggccgagctg aacctggcga cgctgctgac caagcggggc       780
     gcggtgcacg cgatgtcact gcgtcatcgg ccgggcgagc agaaggctgc gatcgtggcc       840
     ggcgtgcgcg ccgaggtgtg gccggcgttc gcgtcgggcg cgatccgccc ggtgatcgac       900
     cgagtgctcc cgctgcgcga ggcggccgag gcgcaccgcg tcgtggagtc cctcgggcat       960
     gtcggcaagg tgctgctcgc ggtctag                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page