(data stored in ACNUC7421 zone)

EMBL: CP002299.PE290

CP002299.PE290       Location/Qualifiers
FT   CDS_pept        complement(363661..365064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6598 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78378"
FT                   /db_xref="GOA:E3J7A5"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7A5"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6598"
FT                   /protein_id="ADP78378.1"
FT                   /translation="MTEASHEIVERALAASRADGCIVIATESSTVNLRWANNTLTTNGA
FT                   ARDRSVTVVSIVGRSFGVRSVSTIEAGTTGVDKLTELVRSAEAAAKDADDAEDYADLLA
FT                   PGQPGAATSPEPFDALAERTSTSVFTRFAADLGEALRAARAEGRGLYGFAEHDLTTTWL
FT                   GTSTGLRLRHSQPTGSVEWNAKNGQPGGSVWHGQATHDFSDVDVAATDAELRRRLGWCA
FT                   RTIDLPAGRYETLLPPSAVSDLILDAYWSAAGRDAAEGRTVFSKAGGGTRLGEAFGPAG
FT                   MTLYSDPADPELSCAPFAVSGHSSATASVFDNGLALGRTNWLDDGKLAALVHTRSSAQA
FT                   AGARPTPFVDNLTMDAGGTATLDDMVASTKRGLLLTCLWYIREVDPEVLLLTGLTRDGV
FT                   YLVENGEVTGAVNNFRFNESPVSLLGRITELGAASRTLGREWADWFKLSRMPAVRVPDF
FT                   NMSSVSPAS"
     gtgaccgagg cgtcgcacga gatcgtcgag cgggcactcg ccgcgtcgcg ggccgacggc        60
     tgcatcgtga tcgcgaccga gtccagcacc gtcaacctgc gctgggcgaa caacacgctc       120
     accacgaacg gggccgcccg agaccggtcg gtcaccgtcg tcagcatcgt cggccgttcc       180
     ttcggcgtgc ggtcggtgag cacgatcgag gccggcacga ccggggtcga caagctgacc       240
     gagctggtcc ggtccgccga ggccgcggcc aaggacgccg acgacgcgga ggactacgcc       300
     gacctgctgg cgcccggtca gcccggcgcg gcgacgagcc ccgagccgtt cgacgccctg       360
     gccgagcgga cctcgacgtc ggtgttcacg aggttcgcgg ccgacctcgg tgaggcgctg       420
     cgggcggcgc gggccgaggg ccgcgggctg tacggcttcg ccgagcacga cctgaccacc       480
     acctggctgg gcacgtccac cgggctgcgg ctgcggcaca gccagccgac cggctcggtc       540
     gagtggaacg ccaagaacgg ccagccgggc ggctcggtct ggcacggcca ggcgacccac       600
     gacttctccg acgtcgacgt ggccgcgacc gacgccgagc tgcgccgccg gctcggctgg       660
     tgcgcccgca ctatcgacct gccggccggc cgctacgaga ccctgctgcc gccgtccgcc       720
     gtctccgacc tgatcctgga cgcctactgg tcggccgccg ggcgggacgc ggcggagggc       780
     cgcacggtct tcagcaaggc cggcggcggg acccggctgg gtgaggcgtt cggccccgcc       840
     gggatgacgc tgtacagcga cccggccgac cccgagctga gctgcgcgcc gttcgccgtc       900
     tcggggcact cgtccgcgac ggcgagcgtc ttcgacaacg ggctcgcgct ggggcggacc       960
     aactggctcg acgacggcaa gctcgccgcc ctcgtgcaca cccggtcctc agcccaggcc      1020
     gccggcgccc ggccgacgcc gttcgtcgac aacctcacga tggacgccgg cgggacggcc      1080
     accctggacg acatggtcgc ctcgaccaag cgggggctgc tgctgacctg cctgtggtac      1140
     atccgcgagg tcgatccgga ggtactgctg ctgaccgggc tgaccaggga cggcgtctac      1200
     ctcgtcgaga acggcgaggt gaccggcgcg gtgaacaact tccggttcaa cgagtcgccg      1260
     gtgagcctgc tcggtcggat caccgagctc ggcgcggcca gccgcaccct gggccgcgag      1320
     tgggccgact ggttcaagct ctcccgcatg ccggcggtac gggtccccga cttcaacatg      1380
     agctcggtca gccccgcgtc atag                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page