(data stored in ACNUC7421 zone)

EMBL: CP002299.PE294

CP002299.PE294       Location/Qualifiers
FT   CDS_pept        369095..369292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0296"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78382"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7A9"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6594"
FT                   /protein_id="ADP78382.1"
FT                   /translation="MQPTPLVTVCGSGGCPTVFTTEDDAVIVQGYLPEPRLSEGVPTGE
FT                   ARVVIPRELLNEAARRLLAS"
     atgcagccaa cccctctggt gactgtgtgc ggctccggag gttgcccgac cgtcttcacg        60
     accgaagacg acgcggtgat cgtccagggc tacctgccgg aacctcgcct ctccgagggc       120
     gttcccacgg gggaagcgcg tgtcgtcatc ccccgggagc tgttgaacga ggcggcgcgc       180
     aggctgttgg cgagctga                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page