(data stored in ACNUC7421 zone)

EMBL: CP002299.PE298

CP002299.PE298       Location/Qualifiers
FT   CDS_pept        372190..372402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0300"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78386"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7B3"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6594"
FT                   /protein_id="ADP78386.1"
FT                   /translation="MELVPLAQSSCGTSTCPGVFEASDGSVVVQGYVVPTQRYADGVPD
FT                   GEARVQIPRDLLIRAARSLPDWDGQ"
     atggagctcg tgccgcttgc ccagtccagc tgcgggacgt cgacgtgccc aggcgtcttc        60
     gaggcgtctg acgggtccgt ggtcgttcag ggttatgttg tgcctacgca gcgctacgct       120
     gacggggtgc cagacgggga ggcccgagtg cagattcctc gcgacctgct catcagagcg       180
     gcgcgcagtc tgccagactg ggatggacag tag                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page