(data stored in ACNUC7421 zone)

EMBL: CP002299.PE299

CP002299.PE299       Location/Qualifiers
FT   CDS_pept        372486..373400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0301"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: fal:FRAAL6593 hypothetical protein; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78387"
FT                   /db_xref="GOA:E3J7B4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7B4"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADP78387.1"
FT                   /translation="MADDIVDVVPSLGVPALGAEPGSSTLAGELGRALAGLRKRKGMTG
FT                   EELGRAIGASQAKISKIERGALRPSPLDVEKIVLALDGSKDALHELVGQATELQALSSR
FT                   PRLPRRGPVNQQDYADLESRATLVRDFEPITVPGLMQISEYTRRVINAFHAVDIGDHES
FT                   KWAETAAKVTQRLQRQERLYDTNKTFEFILLENLLNNMYVTPGYMLAQVDRIEQIAKLP
FT                   NVTVRIVPMTAQLGLPPSHGFMIFDDDVVVTESLDATVYQDRRSVEFYTHFFESYRELA
FT                   NADLFEVLERYKARYADMAMPKP"
     gtggcggacg atattgtcga tgtcgttccg tcacttggcg ttcccgcgct tggtgcggag        60
     ccgggctcct cgacattggc tggggagctc ggtcgcgcgc ttgctgggtt gcgcaagcgc       120
     aaggggatga cgggggagga actcggccgg gcgatcggcg cgagtcaggc gaagatctcg       180
     aagatcgagc ggggagcgct gcggccgagc ccgttggacg ttgagaagat cgtgttggcc       240
     ctggacggtt cgaaggacgc cctgcacgag ttggtggggc aggcgaccga gttgcaggct       300
     ctgagtagcc gcccgcggtt gccgcgtcgt ggcccggtta accagcagga ctatgccgat       360
     cttgagagtc gcgccacgct ggtgcgtgac ttcgagccga tcaccgttcc aggcctgatg       420
     cagatcagtg agtacacccg ccgggtgatc aacgcgttcc atgcggtcga cattggtgac       480
     catgagtcga agtgggccga gactgcggcg aaggtgacgc agcggctcca gcgccaggag       540
     cggctctacg acaccaacaa gacgtttgag ttcatcctgc tggagaacct gctcaacaac       600
     atgtatgtca ctccggggta catgctggcg caggtcgacc gaatcgagca gatcgcgaag       660
     ctgccgaacg tgacggtgcg gatcgtcccg atgacggccc agctcggcct gccaccgagc       720
     cacggattca tgatctttga cgacgatgtg gtcgtcaccg aatccctgga cgcgaccgtc       780
     taccaggacc ggcgcagtgt cgagttctac acccacttct tcgagagcta ccgcgagctc       840
     gcgaatgccg acctcttcga ggtcctcgag cgctacaagg cgcgctacgc cgacatggcg       900
     atgcccaagc cctga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page