(data stored in ACNUC7421 zone)

EMBL: CP002299.PE300

CP002299.PE300       Location/Qualifiers
FT   CDS_pept        complement(373622..374410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0302"
FT                   /product="Cof-like hydrolase"
FT                   /note="KEGG: fal:FRAAL6592 hypothetical protein; TIGRFAM:
FT                   Cof-like hydrolase; HAD-superfamily hydrolase, subfamily
FT                   IIB; PFAM: Haloacid dehalogenase domain protein hydrolase
FT                   type 3"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78388"
FT                   /db_xref="GOA:E3J7B5"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7B5"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ADP78388.1"
FT                   /translation="MSPPAIVATDLDGTLIRSDGTVSERTRRALRRVREHGATVVFVTG
FT                   RPIRVMADVVAKTSVAGIAVCANGALVYDLDAQTTVNHRELDQRAALRLAQAIREMVPD
FT                   VAFAVESGLRFGREPGFRTMWPDPLELVADLADLLVTLPPIKLLVRRSGESLADVYEKV
FT                   VDLAGAEAVVTRSTETLIEIAGAGVSKAVALAEVATARGVTAADVVAFGDMLNDLPMLA
FT                   WAGHAVAVANAHPQVLAAADEITASNDQDGVALVLERLFD"
     gtgtcccctc ccgcgatcgt cgccaccgat ctggacggaa ccctgatccg gtcggacggc        60
     accgtgtcgg agcgcacccg tcgagccctg cgccgggtgc gcgagcacgg cgcgaccgtc       120
     gtgttcgtga ccggccgacc gatccgggtg atggcggacg tcgtcgcgaa gacctcggtc       180
     gccggcatcg ccgtctgcgc gaacggtgcc ctcgtctacg acctggacgc gcagacgacg       240
     gtcaaccatc gcgagctcga ccagcgggcg gcgctacggc tggcccaggc catccgggag       300
     atggtgccgg acgtcgcgtt cgcggtagag agcgggctga ggttcgggcg ggagcccggg       360
     ttccgcacga tgtggcccga cccgctggag ctggtcgccg acctcgccga cctgctggtg       420
     acgctgccac ccatcaagct gctcgttcgc cgcagcggag agtcgctcgc cgacgtctac       480
     gagaaggtcg tggacctcgc gggcgccgag gcggtggtga cccggtccac cgagacgctg       540
     atcgagatcg ccggcgccgg cgtctccaag gcggtcgcgc tggccgaggt cgccaccgcc       600
     cgcggggtca ccgcggcgga cgtcgtcgcc ttcggcgaca tgctcaacga cctgccgatg       660
     ctcgcctggg ccggccacgc cgtcgccgtg gccaacgccc acccgcaggt cctcgcggcc       720
     gccgacgaga ttaccgcctc caacgaccag gacggcgtcg ccctcgttct ggaacgcctc       780
     ttcgactga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page