(data stored in ACNUC7421 zone)

EMBL: CP002299.PE302

CP002299.PE302       Location/Qualifiers
FT   CDS_pept        375021..375866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0304"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="TIGRFAM: ATP phosphoribosyltransferase; KEGG:
FT                   fal:FRAAL6590 ATP phosphoribosyltransferase; PFAM: ATP
FT                   phosphoribosyltransferase catalytic region; Histidine
FT                   biosynthesis protein HisG domain"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78390"
FT                   /db_xref="GOA:E3J7B7"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7B7"
FT                   /inference="protein motif:TFAM:TIGR03455"
FT                   /protein_id="ADP78390.1"
FT                   /translation="MLRIAVPNKGALSAASSQLLGDAGYHVKRDGAELVVADVENDIEF
FT                   FFLRPRDIAVYVGAGRLDVGITGRDLLLDSGVPARELVALGFGHSTFRYAAPKGAIADV
FT                   AELDGLRIATSFPGLVRADFAARGLTAQVVTLDGAVETAVRLGVADAVADVVETGRTLR
FT                   AAGLELVGEPVMRSEAIMITKQGAELGSAQERLLRRVQGVLVARRYVIMDYDAPTDVLE
FT                   KACEITPGFESPTISPLAREGWVAVRAMVLKDDVNRTMDDLWDLGARGILVSAIQACRL
FT                   "
     atgctgcgta tcgcggtacc gaacaagggc gcgctctccg ccgcctccag ccagctgctc        60
     ggcgacgccg ggtaccacgt gaagcgggac ggcgccgagc tcgtcgtcgc cgacgtcgag       120
     aacgacatcg agttcttctt cctgcgcccg cgcgacatcg cggtctacgt cggcgctggc       180
     cgcctcgacg tcggcatcac gggccgcgat ctgctgctgg acagcggggt gccggctcgg       240
     gagctcgtcg cgctcggctt tgggcactcg acgtttcgtt acgcggcgcc gaagggcgcc       300
     atcgccgacg tcgcggagct ggacgggttg cgtatcgcca cctcgttccc cgggctggtc       360
     cgcgcggact tcgcggctcg ggggctgacc gcgcaggtgg tcaccctgga cggcgcggtc       420
     gagaccgcgg tgcgcctggg cgtcgcggac gccgtcgccg acgtcgtgga gaccgggcgc       480
     acgctgcgcg ccgcggggct ggagctcgtc ggtgagccgg tcatgcggtc cgaggccatt       540
     atgatcacca agcagggcgc ggagctcggg tcggcgcagg agcggctgct gcgccgggtc       600
     caaggtgtcc tcgtcgcccg ccgatacgtg atcatggact atgacgcgcc gaccgacgtg       660
     ctggaaaagg cgtgcgagat caccccgggc ttcgagtcac ccacgatctc gccgctggct       720
     cgggagggct gggtcgcggt ccgggccatg gtgctgaagg acgacgtcaa ccgcacgatg       780
     gacgacctgt gggacctcgg tgcccgcggc atcctcgtct ccgcgatcca ggcctgccgc       840
     ctctag                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page