(data stored in ACNUC7421 zone)

EMBL: CP002299.PE307

CP002299.PE307       Location/Qualifiers
FT   CDS_pept        complement(382457..383941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0309"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /note="KEGG: fal:FRAAL6585 putative penicillin-binding
FT                   protein 6 [precursor] (D-alanyl-D-alanine carboxypeptidase
FT                   fraction C (DacC); TIGRFAM: D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase; PFAM:
FT                   peptidase S13 D-Ala-D-Ala carboxypeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78395"
FT                   /db_xref="GOA:E3J7C2"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7C2"
FT                   /inference="protein motif:TFAM:TIGR00666"
FT                   /protein_id="ADP78395.1"
FT                   /translation="MTAGARVGGLTALAGALLAGSLTISPGPGGDKAPGPTVPPVSAAP
FT                   LAGLAANRPLPDPAALSGRLAGPFANPLLGSPAGLVVDGLTGKVLFDQRASVPTAPAST
FT                   LKTAVAAAALRTFSAGTRLTTRVVYLPPPAGPSTPGPGVRQGGTLWLVGAGDPTLTAAT
FT                   GPAGYPASISAKLSELAAQVHAAGITSVSRLIGDGTLYQGPATAPGWKDVYVSEGDVTP
FT                   VSALEVDAGRPTPGAVGPRTGTPDAAAAGAFAAALHTAGVAVGGLGTGPADPAAKTVAT
FT                   AASPPIPVLVERMLTDSDNDIAESLGRLVARAHGLPPTFAGATAAVGKVLTQLGIDTAG
FT                   MSLADVSGLSVTDAIMPRTLVAILRTATLPGHPELRPLITGLPIAGFSGTLGDRYGGTD
FT                   TAPAAGDVRAKTGSLSTVTSLAGQLVDADGRLLLFGFFAPVNESTAAKASLDRVAAALA
FT                   GCGCSAAGPPASTSAGTAPVQPDKGGEPQAATQRGH"
     gtgacagcag gtgcccgggt cggcggcctc accgcgctgg ccggcgcgct gctcgccgga        60
     tcgctgacga tctcccccgg gcccggagga gacaaggcgc ccggcccgac ggtacccccg       120
     gtcagcgcgg cgcctctggc aggcctggcc gcgaaccgcc cgctcccgga tccggccgct       180
     ctttccggcc gcctggccgg gcccttcgcg aacccgctgc tgggcagccc ggcgggcctg       240
     gtggtcgacg gcctgacggg gaaggtcctg ttcgaccaac gggcctcggt gccgaccgcg       300
     cccgcctcga cgctgaagac cgccgtggcc gccgccgcgc tgcgtacctt ctccgccggc       360
     acccggctga cgacccgggt ggtctacctg ccgccccccg ccgggccgtc caccccgggc       420
     ccgggcgtcc gccagggcgg cacgctctgg ctggtcggcg cgggcgaccc gacgctgacc       480
     gccgcgaccg gcccggccgg ctacccggcc agcatcagcg cgaagctctc ggagctggcc       540
     gcccaggtcc acgccgcggg gatcacctcg gtcagccggc tgatcggcga cgggacgctc       600
     taccagggtc cggccaccgc gcccggctgg aaggacgtct acgtgtccga aggcgacgtc       660
     acaccggtct cggcgctgga ggtcgacgcg ggccggccca cgccgggggc tgtcgggccg       720
     agaaccggta ccccggacgc cgccgcggcc ggcgcgttcg cggccgcgct gcacaccgcg       780
     ggcgtcgccg tgggcggcct gggcaccggg ccggccgacc ccgcggccaa gacggtcgcc       840
     acggccgcga gccccccgat cccggtgctg gtcgagcgaa tgctgaccga ctcggacaac       900
     gacatcgccg agagcctcgg ccggctcgtc gcgcgcgccc acgggctgcc gccgacgttc       960
     gccggcgcga ccgccgccgt cggaaaggtg ctgacacagc tcggtatcga caccgccggg      1020
     atgtcactgg ccgatgtgag cggcctgtcg gtgacggacg cgatcatgcc gaggacgctg      1080
     gtggcgattc tgcggaccgc gacgctgccc ggccatcccg agctgcgccc gctgatcacc      1140
     ggcctgccga tcgcgggatt ctccggcacg ctcggcgacc ggtacggcgg caccgacacc      1200
     gcgccggccg ccggcgacgt gcgggcgaag accggcagcc tgagcaccgt caccagcctc      1260
     gccggccagc tcgtcgacgc ggacgggcgg ctgttgctgt tcggcttctt cgcgccggtc      1320
     aacgagtcga cggccgcgaa ggcgagcctc gaccgggtcg ccgctgccct cgccggctgc      1380
     ggctgttccg ccgccgggcc gccggcctcc acgtccgccg gcacggcgcc cgtccagccc      1440
     gacaagggcg gcgagccgca ggcagccacc cagcgcgggc actga                      1485
//

If you have problems or comments...

PBIL Back to PBIL home page