(data stored in ACNUC7421 zone)

EMBL: CP002299.PE309

CP002299.PE309       Location/Qualifiers
FT   CDS_pept        385076..385408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0311"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bid:Bind_2584 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78397"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7C4"
FT                   /inference="similar to AA sequence:KEGG:Bind_2584"
FT                   /protein_id="ADP78397.1"
FT                   /translation="MAVVAWRGLRGAGRLARPPSEATYDPVVSSRLDRSWLVLASHQTA
FT                   EADRCVDIFRRPEGTFGFEEFRKDPEDMGRWTPVSYFSGWQYPTEDETLDAACATVPWL
FT                   GPLVGR"
     gtggctgtcg tggcctggcg cggcctgcgc ggggccggcc ggctggcccg gccgccgagc        60
     gaggcgacgt acgatccggt cgtgtcgtcg cgactcgaca gatcgtggtt ggttctcgcc       120
     agccaccaga cggccgaggc tgatcgctgc gtcgacatct tcagacgccc cgaggggacc       180
     ttcgggttcg aagagttccg caaagaccca gaagacatgg gcagatggac gccggtcagc       240
     tacttctcag gctggcagta cccaacggaa gacgagaccc tcgacgccgc ctgcgcgaca       300
     gtgccctggc tcggcccgct cgtaggccgc tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page