(data stored in ACNUC7421 zone)

EMBL: CP002299.PE310

CP002299.PE310       Location/Qualifiers
FT   CDS_pept        386211..386936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0312"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: fal:FRAAL6583 two-component system response
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain-containing protein; SMART:
FT                   response regulator receiver; transcriptional regulator
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78398"
FT                   /db_xref="GOA:E3J7C5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7C5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADP78398.1"
FT                   /translation="MTGEAVATTTRGASLLVAEDDEASRVALARSLERFGYRVLEAADG
FT                   ETALRLFQTTEIDLVVLDVAMPRMDGFAVLSRLRQTSEVPVIMLTGRAEEVDRVVGLEL
FT                   GADDYVVKPYSLRELVARVRARLRRRPVEAPPQRSGDGNEPLIYGDVSIDLRAREVAVA
FT                   GERIDLTAREYELLAFLARHPRRVFSREELLEQVWGTRFQDPATVTEHVRRVRTKVEGR
FT                   PPQRRLVTTLRGMGYRFDP"
     atgaccgggg aagcagtcgc gacgacgacg cggggagcat cgctcctcgt cgccgaggac        60
     gacgaagcat cgcgcgtcgc actcgcgcgc agtctggaac gtttcggata ccgcgttctg       120
     gaggcggcgg acggcgagac cgcgctgcgc ctgttccaga ccacagagat cgacttggtc       180
     gtgctcgatg tcgcgatgcc gcgcatggac ggctttgccg tgctcagccg gctgcggcag       240
     acgagcgagg tcccggtgat catgctcacc ggccgggccg aggaagtcga ccgggtggtc       300
     ggcctggagc tcggggcgga cgactacgtc gtcaagccgt actcgctgcg cgagctggtc       360
     gcccgggtca gggcccggct gcgccgccgt cccgtggagg cgccgcctca gcggtccggg       420
     gacggcaacg agccgctgat ctacggcgac gtgtcgatcg acctgcgcgc ccgggaggtg       480
     gccgtcgccg gcgagcggat cgatctgacc gctcgcgagt acgagctgct ggccttcctc       540
     gcccggcacc cgcgccgcgt cttcagccgc gaggagctgt tggaacaggt ctggggcacg       600
     cgcttccagg acccggccac ggtgaccgag cacgtccggc gggtccggac gaaggtcgag       660
     gggcggcccc cgcagcgtcg cctcgtcacc accctgcgcg gcatgggcta ccgcttcgac       720
     ccgtga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page