(data stored in ACNUC7421 zone)

EMBL: CP002299.PE311

CP002299.PE311       Location/Qualifiers
FT   CDS_pept        complement(387018..388106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0313"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: fal:FRAAL6582
FT                   signal peptidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78399"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7C6"
FT                   /inference="protein motif:PFAM:PF04468"
FT                   /protein_id="ADP78399.1"
FT                   /translation="MPMMCAVAFSPRGKLYYADPGSLTPKVGDRVLVPTDDGAEVATCM
FT                   WAPQWVSEDIGHLPVLVGLAADHDVEREAASRRRRAQARVAARRLVRDHGLPMKIVGVD
FT                   HVSSADTFTIYFTAEGRVDFRALVRDLNRTLDTRVHLRQLSARDSAKLQGGIGSCGRDL
FT                   CCSTFLTDFEPVSIRMAKDQNLALNPLKISGACGRLMCCLRYEHPLYEEFTAAVPAVGA
FT                   KARTPDGPGRVIAHDVPRQQVVVALDAGGRKACDRSDVCSSRRAHDAAYPATASSGCDS
FT                   AVLAGAGPGQIEADAGRDAAQVGAGSTAAGVATEAVSRGPGPGGAGNAERPDAETAAGQ
FT                   TDSGEGGHHRIRRRRSRPAGPA"
     atgccgatga tgtgcgcggt ggctttctcc cctcgaggga agctctacta cgccgatccc        60
     gggtcactca cgccgaaggt cggcgaccgg gtgctcgtcc cgaccgatga cggcgccgag       120
     gtggccacct gcatgtgggc gccccagtgg gtcagcgagg acatcgggca cctgccggtg       180
     ctggtagggc tcgcggccga ccacgacgtg gagcgtgagg cggcctcgcg gcggcggcgc       240
     gcccaggcga gggtcgccgc caggcgcctg gtccgcgacc acggactgcc gatgaagatc       300
     gtcggagtcg accacgtcag ctccgccgac accttcacga tctacttcac cgccgagggg       360
     cgggtcgact tccgcgcgct cgtccgtgac ctcaaccgga cgttggacac ccgggtccac       420
     ctacgccagc tgtccgcgcg ggacagcgcg aagcttcagg gtgggatcgg ctcctgcggc       480
     cgagacctgt gttgctcgac gttcctcacc gacttcgagc cggtgagcat ccggatggcg       540
     aaggaccaga acctggccct gaacccattg aagatcagcg gtgcctgcgg gcgactgatg       600
     tgctgcctgc gctacgaaca cccgttgtac gaggagttca ccgccgccgt cccggcggtc       660
     ggcgcaaagg cgcgcacgcc cgacggcccc ggccgggtga tcgcccatga cgtaccgcgc       720
     caacaggtcg tcgtcgcgct cgacgcgggg ggccgcaagg cgtgcgaccg gtccgacgtc       780
     tgttcgtccc gccgcgctca cgacgccgcc tacccggcga ccgcgtcctc cggctgcgac       840
     tccgccgtcc tcgccggtgc gggtcccggc cagattgagg ccgacgccgg ccgcgacgcc       900
     gcccaggtcg gcgcgggctc gaccgcggcg ggcgtcgcga cggaggccgt gagccgaggc       960
     ccggggcccg gcggggcggg caacgccgaa cggcccgacg cggaaaccgc ggcgggccag      1020
     accgactcgg gcgaaggggg tcaccatcgg attcggcggc gacgttcccg ccccgccggc      1080
     ccggcctaa                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page