(data stored in ACNUC7421 zone)

EMBL: CP002299.PE316

CP002299.PE316       Location/Qualifiers
FT   CDS_pept        complement(394071..397049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0318"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="SMART: DNA topoisomerase I DNA-binding; DNA
FT                   topoisomerase I ATP-binding; Toprim sub domain-containing
FT                   protein; TIGRFAM: DNA topoisomerase I; KEGG: fal:FRAAL6579
FT                   DNA topoisomerase I omega subunit; PFAM: DNA topoisomerase
FT                   type IA central domain protein; TOPRIM domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78404"
FT                   /db_xref="GOA:E3J7D1"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7D1"
FT                   /inference="protein motif:TFAM:TIGR01051"
FT                   /protein_id="ADP78404.1"
FT                   /translation="MPPRAKTTARTPSRSSTPLAEPLDLDAEIVDLAEQVDDAEPSSGT
FT                   TRGGGRRRAPAGTGNRLVIVESPAKAKTIAGYLGPGWQVESSIGHIRDLPRSAADVPAA
FT                   HKGKPWARLGVDVDNGFAPLYIVTPDKRPQVSKLKELVKDASELYLATDEDREGEAIAW
FT                   HLLQTLKPTVPVKRMVFHEITPQAIRRAVDSPREIDENLVNAQETRRILDRLYGYEVSP
FT                   VLWKKVMPRLSAGRVQSVATRILVERERARMRFRSADYWNIEGRFVATVGHDGKAPDTT
FT                   PLPANLVALDGRRLATGRDFDATGNLTSAEVVRLDEAAARGLAERLAATAFAVRSVETK
FT                   PYKRSPYPPFMTSTLQQEAGRKLRFSSQRTMQIAQKLYENGYITYMRTDSTNLSETALA
FT                   AAREQARQLYGSEYVPDKPRVYTKKVKNAQEAHEAIRPSGDTFRTPGEVRRELDADGFR
FT                   LYELIWQRTVASQMADARGTSATVRLGGKSSTNEDAEFAATGKVITFPGFLRAYVEGAD
FT                   DPDAELEDRETRLPDVRQGDPLATRDLTPRGHSTSPPPRFTEASLVKTLEELGIGRPST
FT                   YASIIGTIQDRGYVWKKGSALIPSFVAFAVVGLLEDHFGRLVDYRFTATMEDDLDAIAS
FT                   GSSGSTDWLTRFYFGDDAAAPVASSAANGKSATPDPGLKHLVSERLGEIDAREVNSIPL
FT                   GAAEDGVPVVVRVGRYGPYVQHGEGRASVPEDLPPDELTIPKALELLDAPSGDRVLGTD
FT                   PDNGATITAKAGRYGPYVTTDTEPPRTASLLSTMSLETLTLDDARKLLTLPRVLGAGED
FT                   GEEITAQNGRYGPYVKHGTQSRSLANEEQLFTVTLQEALDLLAQPKTRGRRSAAEIPPL
FT                   RELGADPATGKPMVLKEGRFGPYVTDGETNASLRKGDEIDTLTIERAAELLADRRARGP
FT                   ATPRRANARAGSKAPAKAGSTAKAKSSARASSAAKATAKTTTKTGTRATKRSASGADGA
FT                   GEG"
     gtgccaccgc gcgcgaagac gacggcccgg accccgtccc ggtcgtccac accgctagcc        60
     gaaccgctcg acctcgacgc cgagatcgtc gacctggccg agcaggtcga cgacgccgag       120
     ccgtcgtccg gtaccacccg cggcggcggg cgcaggcggg caccggcggg caccggcaac       180
     cgactggtga tcgtcgagtc gcccgcgaag gcgaagacga tcgcgggcta cctcgggccg       240
     ggctggcagg tcgagtcgag catcggccac atccgcgacc tgccgcgcag cgccgcggac       300
     gtgccggccg cgcacaaggg caagccgtgg gcccggctcg gggtggacgt ggacaacggc       360
     ttcgcgccgc tctacatcgt caccccggac aagcgcccgc aggtgtccaa gctcaaggag       420
     ctggtcaagg acgcgagcga gctctacctc gcgacagacg aggaccgcga gggcgaggcg       480
     atcgcctggc acctgctgca gacgctcaag ccgacggtcc cggtcaagcg gatggtcttc       540
     cacgagatca ccccgcaggc gatccggcgc gcggtcgaca gcccgcgcga gatcgacgag       600
     aacctcgtca acgcccagga gacccggcgc atcctggacc ggctctacgg ctacgaggtc       660
     tcccccgtgc tgtggaagaa ggtcatgccg cgcctttcgg ccggccgggt gcaaagcgtc       720
     gcgacgcgca tcctggtcga gcgcgagcgg gccaggatgc ggttccgctc cgctgactac       780
     tggaacatcg agggccggtt cgtcgccacc gtcggccacg acggcaaggc acccgacacg       840
     acgccgctgc cggcgaacct ggtggccctc gacggccgtc ggctggcgac cggccgcgac       900
     ttcgacgcca ccggcaacct gacctcggcc gaggtcgtcc ggctcgacga ggccgcggcc       960
     cggggcctcg ccgaacggct ggccgccacc gcgttcgcgg tccgctcggt cgagaccaag      1020
     ccgtacaagc gctcgccgta cccgcccttc atgacctcca cgctgcagca ggaggcgggc      1080
     cgcaagctgc ggttctccag ccagcgcacg atgcagatcg cgcagaagct gtacgagaac      1140
     ggctacatca cctacatgcg aaccgactcg acgaacctgt ccgagacggc gctggcggcg      1200
     gcccgcgagc aggcccggca gctctacggg tcggagtacg tgccggacaa gccccgggtc      1260
     tacacgaaga aggtcaagaa cgcccaggag gcgcacgagg cgatccgccc ctccggcgac      1320
     acgttccgca ccccgggcga ggtccgccgc gagctcgacg ccgacggctt ccgcctctac      1380
     gagctgatct ggcagcgcac ggtcgccagc cagatggccg acgcccgcgg caccagcgcg      1440
     accgtccggc tcggcggcaa gtccagcacg aacgaggacg ccgagttcgc cgcgaccggc      1500
     aaggtcatca ccttccccgg cttcctgcgg gcctacgtcg agggcgccga cgacccggac      1560
     gcggagctcg aggaccgcga gacccggctg cccgacgtcc gccagggcga cccgctggcc      1620
     acccgcgacc tcaccccacg cggccactcg accagcccgc cgccccggtt caccgaggcg      1680
     agcctggtca agacgctgga ggagctgggc atcggccgcc cgtcgaccta cgcgtcgatc      1740
     atcggcacga tccaggaccg cggctacgtc tggaagaagg gctcagcgct catccccagc      1800
     ttcgtcgcgt tcgccgtcgt cgggctgttg gaggaccact tcggccggct ggtcgactac      1860
     cggttcaccg cgacgatgga ggacgacctc gacgccatcg cgtccggttc gtccggatcg      1920
     accgactggc tcacccggtt ctacttcggc gatgacgccg ccgccccggt ggcgtcatcg      1980
     gccgcgaacg gcaagagcgc cacccccgac ccgggcctga agcacctcgt cagcgagcgg      2040
     ctcggcgaga tcgacgcccg tgaggtcaac tcgatcccgc tcggcgccgc cgaggacggg      2100
     gttccggtcg tcgtccgggt cggccggtac ggcccctacg tccagcacgg cgagggccgg      2160
     gccagcgtgc ccgaggacct gccaccggac gagctgacga tcccgaaggc gctggagctg      2220
     ctcgacgcgc cgtcgggcga ccgggtgctc ggcaccgacc ctgacaacgg cgccacgatc      2280
     accgccaagg cgggccgcta cggcccctac gtcaccaccg acaccgagcc gccgcgcacc      2340
     gcgagcctgc tgtcgaccat gtcgctggag acgctgaccc tcgacgacgc ccgcaagctg      2400
     ctcaccctgc cccgggtgct cggcgccggc gaggacggtg aggagatcac cgcccagaac      2460
     ggccgctacg gcccctacgt caagcacggg actcagagcc gctcgctggc gaacgaggag      2520
     cagctgttca cggtgacgct ccaggaggcg cttgacctgc tggcccagcc gaagacgcgg      2580
     ggccggcgca gcgcggccga gatcccgccg ctgcgcgagc tcggcgcgga cccggcgacc      2640
     ggtaagccga tggtgctcaa ggagggccgg ttcggcccgt acgtcaccga cggcgagacc      2700
     aacgccagcc tgcgcaaggg cgacgagatc gacaccctga cgatcgagcg cgccgccgag      2760
     ctgctcgccg accggcgggc ccggggcccg gcgaccccgc gccgcgccaa cgctcgggcc      2820
     ggctccaagg cgccggcgaa ggctgggagc accgccaagg cgaagtcctc ggcacgcgcg      2880
     tcgtccgccg ccaaggccac ggcgaagacg accacgaaga ccggcacgcg cgcgacgaag      2940
     cggtccgcgt ccggcgctga cggcgccggc gagggttga                             2979
//

If you have problems or comments...

PBIL Back to PBIL home page