(data stored in ACNUC7421 zone)

EMBL: CP002299.PE317

CP002299.PE317       Location/Qualifiers
FT   CDS_pept        complement(397634..400018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0319"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="TIGRFAM: V-type H(+)-translocating pyrophosphatase;
FT                   KEGG: fal:FRAAL6577 membrane-bound proton-translocating
FT                   pyrophosphatase; PFAM: Inorganic H pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78405"
FT                   /db_xref="GOA:E3J7D2"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7D2"
FT                   /inference="protein motif:TFAM:TIGR01104"
FT                   /protein_id="ADP78405.1"
FT                   /translation="MPPIQAAESPAGTGIDLTGGQLGLVAGVALIAALALLVAGYLVRE
FT                   VLAASQGGPKMIEVGKAVQEGAAAYLSRQFKTLAAFVVVIPFVLLALPADDLGARIGRS
FT                   AFFVVGAVFSALVGFVGMSLATRANTRTAAAANERGEKAALRLAFRTGGVVGMFTVGLG
FT                   LLGAAVVVLIFKHTAPQVLEGFGFGAALLAMFMRVGGGIFTKAADVGADLVGKVEKGIP
FT                   EDDPRNAATIADNVGDNVGDCAGMAADLFESYAVTLVAALILGIKAFGSHGLVFPLLIP
FT                   AIGVITAVIGIFAVAPRSGDRDGMAAINRGFFISAVISAIGVVVVALVYLPGSFKGFHD
FT                   LAGGVPKGDPRVIAISACLIGIVLAAAIQLLTGYFTETKRKPVRSVVDASTTGPATNIL
FT                   AGIGVGLESAVYSAVLISAAVFGAYLLGSGSITVALFAVAMAGTGLLTTVGVIISMDTF
FT                   GPVSDNAQGIAEMSGEVTEEGATILTSLDAVGNTTKAITKGIAIATAVFAATALFGSFT
FT                   DTITEALAKAGVNPSTTRGTIGGLNVAYPDALVGLILGAAVVFLFSGLAINAVGRAAGR
FT                   VVWEVRKQFQDHPGIMEGTEKPDYGAVVDICTRDSLRELVTPGTLAVMAPIAVGFGLGY
FT                   PPLGCYLAGAIAGGVLMAVFLANSGGAWDNAKKLVEDGMHGGKGSDVHAATVIGDTVGD
FT                   PFKDTAGPAINPLIKVMNLVSLLIAPTVVKFSVGQDKNTWLRVLIAIVALAVIATVITI
FT                   SKRRGSALDAVPGDSGTAVSSNVVVATAAGQPATAPDQVNV"
     atgcccccga tccaggccgc ggagtcaccc gcgggcactg ggatcgacct tactggcggg        60
     caactgggat tggtcgccgg tgtggcgctc atcgcagcgt tggccctgct ggtggccggt       120
     tatctggtcc gcgaagtgct cgcggcgagc cagggcggcc ccaagatgat cgaggtagga       180
     aaggccgtcc aggagggtgc cgcggcctac ctcagtcgac agttcaaaac cctggccgcg       240
     ttcgtcgtcg tcatcccgtt cgtgttgctg gccctgccgg ccgacgacct gggcgcccgg       300
     atcggacggt cggcgttctt cgtcgtgggt gcggtgttct ccgcgctcgt cggcttcgtc       360
     ggcatgtcgc tggcgaccag ggcgaacacc aggaccgcgg cggccgccaa cgagcgcggt       420
     gagaaggccg cgcttcggct ggccttccgc accggcggcg tcgtcggcat gttcaccgtc       480
     ggcctcggcc tgctcggtgc cgcggtggtg gtgctgatct tcaagcacac cgcgccgcag       540
     gtactggagg gattcggctt cggcgccgcg ctgctcgcga tgttcatgcg ggtcggcggc       600
     ggcatcttca ccaaggccgc ggacgtcggc gccgacctgg tcggcaaggt ggagaagggc       660
     atccccgagg acgacccccg taacgcggcg acgatcgcgg acaacgtcgg ggacaacgtc       720
     ggcgactgcg ccggcatggc ggccgacctc ttcgagtcgt acgcggtcac cctggtggcc       780
     gcgctcattc tcgggatcaa ggccttcggc tcgcacgggc tggtgttccc gctgctgatc       840
     ccggcgatcg gcgtcatcac cgccgtcatc gggatcttcg cggtggcccc gcggtcgggt       900
     gaccgggacg ggatggccgc gatcaaccgc gggttcttca tctcggccgt catctccgcg       960
     atcggcgtcg tggtggtcgc gctcgtctac ctgccgggca gcttcaaggg cttccacgac      1020
     ctggccggcg gcgtcccgaa gggtgacccg cgggtcatcg ccatcagcgc ctgcctcatc      1080
     ggaatcgtgc tggcggcggc gatccagctg ctcaccggct atttcaccga gacgaagcgc      1140
     aagccggtcc gcagcgtggt ggacgcctcc accaccggcc ccgccaccaa catcctggct      1200
     ggcatcgggg ttggcctgga atcggcggtc tactcggcgg tcctgatcag cgcggcggtg      1260
     ttcggcgcct acctgctcgg ctccgggagc atcaccgtcg cgctgttcgc tgtcgcgatg      1320
     gccggaaccg gcctgctgac caccgtcggc gtcatcatct cgatggacac cttcgggccg      1380
     gtgagcgaca acgcgcaggg catcgccgag atgtccggcg aggtcaccga ggagggggca      1440
     acgatcctca cctcgctcga cgcggtcggc aacaccacga aggccatcac caagggcatc      1500
     gcgatcgcca ccgcggtgtt cgccgcgacg gcgctgttcg ggtcgttcac cgacaccatc      1560
     accgaggctc tcgccaaggc gggcgtcaac ccgagcacca cccgcggcac catcggcggc      1620
     ctgaacgtcg cctacccgga cgcgctggtc ggcctgatcc tcggcgccgc cgtcgtgttc      1680
     ctgttctccg gcctcgcgat caacgccgtc ggccgggccg ccgggcgggt cgtctgggag      1740
     gtgcgcaagc agttccagga ccacccgggg atcatggagg gcaccgagaa gcccgactac      1800
     ggcgcggtcg tcgacatctg cacccgtgac tcgctgcggg agctggtgac acccggcacg      1860
     ctcgccgtga tggcaccgat cgcggtcggc ttcggtctcg gctacccgcc cctgggctgc      1920
     tacctcgccg gcgcgatcgc cggtggtgtg ctcatggccg tcttcctcgc gaactcgggc      1980
     ggtgcctggg acaacgccaa gaagctggtc gaggacggca tgcacggcgg gaagggctcc      2040
     gacgtccacg ccgccacggt catcggcgac accgtcgggg acccgttcaa ggacacggcc      2100
     ggcccggcga tcaacccgtt gatcaaggtg atgaacctgg tcagcctgct gatcgcgcca      2160
     actgtggtca agttctccgt cggccaggac aagaacacct ggctgcgggt tctcatcgcg      2220
     atcgtggcgc tcgccgtgat cgcgacggtg atcacgatct cgaagcggcg cggctcggcg      2280
     ctcgacgccg ttccgggaga cagcgggacc gcggtctcgt cgaacgtcgt cgtggcgacg      2340
     gcggctggcc agccggcgac cgcccccgac caggtgaacg tctga                      2385
//

If you have problems or comments...

PBIL Back to PBIL home page