(data stored in ACNUC7421 zone)

EMBL: CP002299.PE32

CP002299.PE32        Location/Qualifiers
FT   CDS_pept        38326..39561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0032"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="TIGRFAM: spermidine/putrescine ABC transporter
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Transport-associated OB domain-containing protein; KEGG:
FT                   fal:FRAAL6832 polyamine ABC-transporter ATP-binding
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78120"
FT                   /db_xref="GOA:E3J282"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J282"
FT                   /inference="protein motif:TFAM:TIGR01187"
FT                   /protein_id="ADP78120.1"
FT                   /translation="MRVLAVTADGVSTSVPAVSTPTVPTGGTGAAAPAIELIGVAKDYA
FT                   SRRGAVTAVETVDLQIAEGEFFSLLGPSGCGKTTTLRMIGGFEEPSRGQILLHGSDVTA
FT                   TPPNRRDVNLVFQSYALFPHLDVAGNVAFGLKRKGIRGQAMRDRVTNMLELVELGALAD
FT                   RKPKELSGGQQQRVALARALVNEPRALLLDEPLGALDLKLRETMQIELKRIQREVGITF
FT                   VYVTHDQSEALTMSDRIAVMNKGRIEQLAAPRDLYERPRTRFVAGFIGTSNVLRRTVKT
FT                   VTTDGTGPVAILDAGIDEQLMVPLHDDLGSVTTGSVVELTVRPEKIGMTVERPDGDVCL
FT                   LRGRVTEVVYLGTNTTYTVFTPGGDEITVFWQNSSDSADIARRGDEVWLSWREDHSFAL
FT                   APGAGSSTPAAA"
     gtgcgggtct tggcggtgac cgcggacggg gtgtcgacgt cggtgccggc ggtcagtacg        60
     ccgacggtgc ccaccggtgg aacgggtgcg gcggcgccag ccatcgagct gatcggcgtc       120
     gcgaaggact acgcctcgcg gcgcggcgcc gtgacggccg tggagaccgt cgacctccag       180
     atcgccgagg gcgagttctt ctcgttgctg ggcccgtcgg gctgcggcaa gacgacgacg       240
     ctgcgcatga tcggtggctt cgaggagccg agccgcggcc agatcctgct gcacggcagc       300
     gacgtgaccg cgaccccgcc gaaccggcgg gacgtcaacc tggtcttcca gagctacgcg       360
     ctcttcccac acctcgacgt cgcgggcaac gtcgccttcg gcctgaagcg caagggcatc       420
     cgcggccagg cgatgcgcga ccgggtgacc aacatgctcg agctggtcga gctcggcgcg       480
     ctggccgacc gcaagcccaa ggagctctcc ggcggccagc agcagcgggt cgcgctggcc       540
     cgggcactgg tgaacgagcc gagggcactg ctgctcgacg agccgctcgg cgcgctcgac       600
     ctgaagctgc gcgagaccat gcagatcgag ctcaagcgca tccagcgcga ggtcgggatc       660
     acgttcgtct acgtgacgca cgaccagagc gaggcgctca ccatgtcgga ccgcatcgcg       720
     gtcatgaaca agggccgcat cgagcagctg gccgccccgc gcgacctcta cgagcgaccg       780
     cgtacgcggt tcgtcgcggg cttcatcggc acgtccaacg tgctgcgccg gacggtcaag       840
     acggtgacca ccgacgggac cggtccggtc gcgatcctgg acgcggggat cgacgagcag       900
     ttgatggtgc ccctgcatga cgacctgggg tcggtgacga cgggctccgt ggtcgagctg       960
     accgtgcgtc cggagaagat cggcatgacg gtcgagcggc cggacggcga cgtgtgcctg      1020
     ctgcgcgggc gggtcaccga ggtcgtctac ctggggacca acaccaccta cacggtgttc      1080
     accccgggcg gcgacgagat cacggtcttc tggcagaaca gctctgactc cgccgacatc      1140
     gcgcgccgtg gggacgaggt ctggctctcc tggcgggagg accactcgtt cgccctcgcg      1200
     cctggcgcgg gcagctccac ccccgccgcc gcctga                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page