(data stored in ACNUC7421 zone)

EMBL: CP002299.PE324

CP002299.PE324       Location/Qualifiers
FT   CDS_pept        complement(407279..407572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0326"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6568 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78412"
FT                   /db_xref="GOA:E3J7D9"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7D9"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6568"
FT                   /protein_id="ADP78412.1"
FT                   /translation="MSLLPTVVSLAAMVAGCAVLAHGLARRPAEDRHATPGRPGQLRRE
FT                   DRPGDAGMSTAEYAVGTVAAVAFAGVLYAVVSSSATHDLIMSVVRRALTLPF"
     atgtccctgc tgcccacagt cgtctcactg gccgcgatgg tggcgggctg cgccgtcctg        60
     gcccacggcc tggcgcggcg cccagccgag gaccggcacg ccacgccggg ccggcccggt       120
     cagctccgcc gggaggaccg gcccggcgac gccggcatgt cgacggccga gtacgccgtc       180
     ggcacggtcg ccgcggtggc gttcgcggga gtgctctacg cggtcgtcag cagttcggcg       240
     acccacgacc tgatcatgtc ggtggtccgc cgcgcgctga cgctcccctt ctga             294
//

If you have problems or comments...

PBIL Back to PBIL home page